Glyma01g07743 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g07743

Feature Type:	gene_model
Chromosome:	Gm01
Start:	8512444
stop:	8513748
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g07743

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G69210	AT	Annotation by Michelle Graham. TAIR10: Uncharacterised protein family UPF0090 \| chr1:26018583-26020058 REVERSE LENGTH=305	SoyBase	E_val: 7.00E-54	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009560	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02576	PFAM	Uncharacterised BCR, YhbC family COG0779	JGI		ISS
UniRef100_G7JY21	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribosome maturation factor rimP n=1 Tax=Medicago truncatula RepID=G7JY21_MEDTR	SoyBase	E_val: 1.00E-71	ISS
UniRef100_I1JEH0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JEH0_SOYBN	SoyBase	E_val: 1.00E-87	ISS

Expression Patterns of Glyma01g07743

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g07743 not represented in the dataset	Glyma01g07743 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g07743

Paralog	Evidence	Comments
Glyma02g13240	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g07743 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g061900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g07743

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g07743

Limit To All Plant Sequences

>Glyma01g07743.1   sequence type=CDS   gene model=Glyma01g07743   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATCATGGCATATGCCTCAAACTTGATTACCCATTGCTGCATAATTTACTTTGTTTACGATATGGGTGTCCAAGCATGGAAGAGCTTGAATGCTACAATCAGAAATACAAGACAAGATTAGATGAAGTTGGAGCGCTAGGAGAGATACCTGTTGATTTGGCTCTGGAGGTTTCATCCCCAGGCGCTGAGAGGCTACTAAAAGTGCCAGATGATATTAGTCGATTCAAAGACATGACTATGAGAGTCTGTTATACTGAAAATATAGAGTCCAATTGCCCAGAAAGGGATGGAGTTTTTTTGTTAGATTCTATAGAAAATGACTCGGAGATGTGTGTGTGGAAGTTTGCAGACGTTAAAGAGAATAGAGACCCCCTTAAAAAAGGCAGACCTTTAAGTCGTAAACAGAAGGATTGGAGATTAAAACTGCCATTTAACTTGCATACAATGGTAACTTTGTACCTTGAATAA

Predicted protein sequences of Glyma01g07743

Limit To All Plant Sequences

>Glyma01g07743.1   sequence type=predicted peptide   gene model=Glyma01g07743   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYHGICLKLDYPLLHNLLCLRYGCPSMEELECYNQKYKTRLDEVGALGEIPVDLALEVSSPGAERLLKVPDDISRFKDMTMRVCYTENIESNCPERDGVFLLDSIENDSEMCVWKFADVKENRDPLKKGRPLSRKQKDWRLKLPFNLHTMVTLYLE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain