SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g07256): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g07256): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g07256

Feature Type:gene_model
Chromosome:Gm01
Start:7805184
stop:7807029
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g07256
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G43650AT Annotation by Michelle Graham. TAIR10: nodulin MtN21 /EamA-like transporter family protein | chr1:16444526-16446814 REVERSE LENGTH=206 SoyBaseE_val: 3.00E-46ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
PF00892PFAM EamA-like transporter family JGI ISS
UniRef100_G7KHQ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 5NG4 n=1 Tax=Medicago truncatula RepID=G7KHQ6_MEDTR SoyBaseE_val: 6.00E-86ISS
UniRef100_UPI0002337423UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337423 related cluster n=1 Tax=unknown RepID=UPI0002337423 SoyBaseE_val: 6.00E-123ISS

Expression Patterns of Glyma01g07256
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g07256 not represented in the dataset
Glyma01g07256 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g07256 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g059500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g07256
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g07256
>Glyma01g07256.1   sequence type=CDS   gene model=Glyma01g07256   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAGTTTTTTGTTGTGGCGTGTGGCCATTGTGGAAAAAAATAGACCCTATGTTGCAATGTTGTTCATTCAGTTTGTGTATGCTGGAATGGCCTTGCTTTCCAAGGCTGCAATTTCCAAGGAAATGAGCCCTTATGTGTTTGTTGTTTATAGACAAGCCTTTGCATCAGTTGCTCTATCTCCATTTGCTTTCTTTGACAGCAAGCAATCAGCTCCTTTGTCATGCAACTTGTTGTGCAAATTGTTGTGCAAATTGTTTCTAGTTTCCCTTGTTGGGTTAACTGCAAGTTCAAACCTTTACTATGTTTCAATCAACTACACCACTGCAACATTTGCTGCAGCCGCCACAAATACTGTCCCTGCCATTACTTTCATCATGGCTGTTTTAATTAGGATGGAAAGCATTTCCGTAAAACGTGTGCATGGATTGGCCAAGATTTTGGGGTCCGTTCTAAGCCTTGCTGGGGCAATAACATTTGCTTTAGTCAAAGGACCTCACCTGGGTTTCATGAAATGCTATCCAGAAAATTAG
Predicted protein sequences of Glyma01g07256
>Glyma01g07256.1   sequence type=predicted peptide   gene model=Glyma01g07256   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSFLLWRVAIVEKNRPYVAMLFIQFVYAGMALLSKAAISKEMSPYVFVVYRQAFASVALSPFAFFDSKQSAPLSCNLLCKLLCKLFLVSLVGLTASSNLYYVSINYTTATFAAAATNTVPAITFIMAVLIRMESISVKRVHGLAKILGSVLSLAGAITFALVKGPHLGFMKCYPEN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo