Report for Sequence Feature Glyma01g07070
Feature Type: gene_model
Chromosome: Gm01
Start: 7614282
stop: 7618124
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma01g07070
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G26480 AT
Annotation by Michelle Graham. TAIR10: general regulatory factor 12 | chr1:9156573-9157845 REVERSE LENGTH=268
SoyBase E_val: 1.00E-160 ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0019904 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein domain specific binding
SoyBase N/A ISS
GO:0045309 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein phosphorylated amino acid binding
SoyBase N/A ISS
KOG0841
KOG
Multifunctional chaperone (14-3-3 family)
JGI ISS
PTHR18860 Panther
14-3-3
JGI ISS
PF00244 PFAM
14-3-3 protein
JGI ISS
UniRef100_E9KNA7 UniRef
Annotation by Michelle Graham. Best UniRef hit: SGF14e n=1 Tax=Glycine max RepID=E9KNA7_SOYBN
SoyBase E_val: 0 ISS
UniRef100_E9KNA7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: SGF14e n=1 Tax=Glycine max RepID=E9KNA7_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma01g07070
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma01g07070
Paralog Evidence Comments
Glyma02g12930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma01g07070 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.01g058000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma01g07070
Coding sequences of Glyma01g07070
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma01g07070.1 sequence type=CDS gene model=Glyma01g07070 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCCGCCGAGAAAGAGAGAGAGACCCAGGTTTACTTGGCCAAGCTTGCCGAGCAGGCCGAGAGATACGAAGAAATGGTTGAGTGTATGAAGAAAGTAGCAAAACTTGATCTTGATCTAACTGTGGAAGAAAGGAACCTCCTCTCAGTGGGATACAAAAATGTGATTGGTGCACGAAGGGCCTCTTGGCGCATCATGTCCTCAATTGAGCAGAAGGAAGAGTCTAAGGGAAATGAGCACAATGTTAAACTGATCAAGAGTTACTGCCAAAAAGTTGAGGAGGAACTCTCCAAAATTTGTGGGGACATTCTGACTATTATAGACCAGCATTTGATTCCTTCTTCCGCATCAGCAGAAGCTAGTGTTTTCTACTATAAGATGAAAGGTGATTATTTTCGGTATCTTGCTGAGTTCAAGACTGACCAAGAAAGGAAAGAGGCAGCTGAACAGTCACTGAAAGGATACGAGGCTGCTTCAGCCACTGCAAACACAGATCTTCCATCAACACATCCAATCCGTCTTGGACTTGCACTCAATTTCTCTGTCTTTTATTATGAGATAATGAACTCTCCTGAAAGGGCCTGCCATTTGGCTAAGCAAGCTTTTGATGAGGCAATTGCGGAGTTGGACACCCTGAGTGAAGAGTCATACAAGGACAGCACTTTGATCATGCAGCTGTTGAGAGACAACCTGACTCTCTGGACCTCTGATTTGCCTGAGGATGGAGGTGAGGACAGCATAAAAGCTGAAGAAACCAAACCTTCTGAGCCTGAGCATTGA
Predicted protein sequences of Glyma01g07070
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma01g07070.1 sequence type=predicted peptide gene model=Glyma01g07070 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSAEKERETQVYLAKLAEQAERYEEMVECMKKVAKLDLDLTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKSYCQKVEEELSKICGDILTIIDQHLIPSSASAEASVFYYKMKGDYFRYLAEFKTDQERKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDLPEDGGEDSIKAEETKPSEPEH*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
