|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G42970 | AT | Annotation by Michelle Graham. TAIR10: glyceraldehyde-3-phosphate dehydrogenase B subunit | chr1:16127552-16129584 FORWARD LENGTH=447 | SoyBase | E_val: 2.00E-50 | ISS |
| GO:0006006 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucose metabolic process | SoyBase | N/A | ISS |
| GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
| GO:0006098 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt | SoyBase | N/A | ISS |
| GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
| GO:0006636 | GO-bp | Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009416 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to light stimulus | SoyBase | N/A | ISS |
| GO:0009637 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to blue light | SoyBase | N/A | ISS |
| GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
| GO:0009657 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plastid organization | SoyBase | N/A | ISS |
| GO:0009744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus | SoyBase | N/A | ISS |
| GO:0009749 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus | SoyBase | N/A | ISS |
| GO:0009773 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I | SoyBase | N/A | ISS |
| GO:0009902 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chloroplast relocation | SoyBase | N/A | ISS |
| GO:0010114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to red light | SoyBase | N/A | ISS |
| GO:0010155 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of proton transport | SoyBase | N/A | ISS |
| GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
| GO:0010218 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to far red light | SoyBase | N/A | ISS |
| GO:0010304 | GO-bp | Annotation by Michelle Graham. GO Biological Process: PSII associated light-harvesting complex II catabolic process | SoyBase | N/A | ISS |
| GO:0015994 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process | SoyBase | N/A | ISS |
| GO:0015995 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process | SoyBase | N/A | ISS |
| GO:0019216 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process | SoyBase | N/A | ISS |
| GO:0019253 | GO-bp | Annotation by Michelle Graham. GO Biological Process: reductive pentose-phosphate cycle | SoyBase | N/A | ISS |
| GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
| GO:0019344 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process | SoyBase | N/A | ISS |
| GO:0031408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0042744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0010319 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: stromule | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0004365 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | SoyBase | N/A | ISS |
| GO:0016620 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor | SoyBase | N/A | ISS |
| GO:0047100 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity | SoyBase | N/A | ISS |
| GO:0050661 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADP binding | SoyBase | N/A | ISS |
| GO:0051287 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NAD binding | SoyBase | N/A | ISS |
| PTHR10836 | Panther | GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE | JGI | ISS | |
| PF00044 | PFAM | Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | JGI | ISS | |
| UniRef100_I1K7A8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7A8_SOYBN | SoyBase | E_val: 2.00E-55 | ISS |
| UniRef100_Q38IX0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glyceraldehyde-3-phosphate dehydrogenase B subunit n=1 Tax=Glycine max RepID=Q38IX0_SOYBN | SoyBase | E_val: 5.00E-55 | ISS |
|
Glyma01g06203 not represented in the dataset |
Glyma01g06203 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g051800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g06203.1 sequence type=CDS gene model=Glyma01g06203 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTAGGAACCTTTAAAACAGATGTGAAAATACTAGACAATGAAACCATCACTGTTGATGGTAAGCCCATCAAGGTTGTTTCAAGCAGGGACCCTCTTAAGCTTCCTTGGGCTGAGCTTGGAATTGACATTGTTATTGAGGGAACGAGAGTGTTTGTGGATGGCCCTGGGGCTGGCAAAAACATCCAAGCAGGTGCCAAGAAGGTTATTATCACTGCTCCTGCAAAGGGTGCTGATATCCCAATTTATATTGTCGGAATAAATGAAGGGGACTACACTCATGAGACCTCTAACATTGAAACGCTCTGCATGCTTTGTGAAGCAGGCTTTCTGACCCTAGCAATGTGCTACACAGCTGGGATCCAACTCTCGTTAATGCTTGTACTTGGTTTCATGTTACCTGTGACTCCAGAAATCTCGTGA
>Glyma01g06203.1 sequence type=predicted peptide gene model=Glyma01g06203 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLGTFKTDVKILDNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTRVFVDGPGAGKNIQAGAKKVIITAPAKGADIPIYIVGINEGDYTHETSNIETLCMLCEAGFLTLAMCYTAGIQLSLMLVLGFMLPVTPEIS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||