SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G61440 | AT | Annotation by Michelle Graham. TAIR10: cysteine synthase C1 | chr3:22736550-22737792 FORWARD LENGTH=247 | SoyBase | E_val: 9.00E-28 | ISS |
| GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
| GO:0006535 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process from serine | SoyBase | N/A | ISS |
| GO:0006833 | GO-bp | Annotation by Michelle Graham. GO Biological Process: water transport | SoyBase | N/A | ISS |
| GO:0006972 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic response | SoyBase | N/A | ISS |
| GO:0007030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi organization | SoyBase | N/A | ISS |
| GO:0008152 | GO-bp | Annotation by Michelle Graham. GO Biological Process: metabolic process | SoyBase | N/A | ISS |
| GO:0009266 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0009684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009750 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus | SoyBase | N/A | ISS |
| GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
| GO:0019344 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process | SoyBase | N/A | ISS |
| GO:0019499 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cyanide metabolic process | SoyBase | N/A | ISS |
| GO:0019500 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cyanide catabolic process | SoyBase | N/A | ISS |
| GO:0019761 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process | SoyBase | N/A | ISS |
| GO:0032880 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of protein localization | SoyBase | N/A | ISS |
| GO:0042744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0051410 | GO-bp | Annotation by Michelle Graham. GO Biological Process: detoxification of nitrogen compound | SoyBase | N/A | ISS |
| GO:0080147 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair cell development | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0004124 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cysteine synthase activity | SoyBase | N/A | ISS |
| GO:0005507 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: copper ion binding | SoyBase | N/A | ISS |
| GO:0030170 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding | SoyBase | N/A | ISS |
| GO:0050017 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: L-3-cyanoalanine synthase activity | SoyBase | N/A | ISS |
| PTHR10314 | Panther | PYRIDOXAL-5-PHOSPHATE DEPENDENT BETA FAMILY | JGI | ISS | |
| PTHR10314:SF8 | Panther | THREONINE DEHYDRATASE | JGI | ISS | |
| PF00291 | PFAM | Pyridoxal-phosphate dependent enzyme | JGI | ISS | |
| UniRef100_A5YT86 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cysteine synthase n=1 Tax=Glycine max RepID=A5YT86_SOYBN | SoyBase | E_val: 3.00E-29 | ISS |
| UniRef100_A5YT86 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Cysteine synthase n=1 Tax=Glycine max RepID=A5YT86_SOYBN | SoyBase | E_val: 3.00E-29 | ISS |
|
Glyma01g06131 not represented in the dataset |
Glyma01g06131 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g051100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g06131.1 sequence type=CDS gene model=Glyma01g06131 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTACAACAATTTTCAAACCCTGCCAATACTCTAGTGCATTTTGAAACAACATGGCCTGAGATATGGGAGGATACAAATGGACAAGTTGACATATTTGTTATGGGAATAGGTAGTGATGGCACAGTCTTTGGGGTTGGGCAATATCTTAAATCCAAAAATCCTAATGTTAAGATATATGAAGTGGAGCCAAGTGAAAGCAATATCACTACTAAAAAAAGTGGTGCGGTGGCATTTTTGTAA
>Glyma01g06131.1 sequence type=predicted peptide gene model=Glyma01g06131 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLQQFSNPANTLVHFETTWPEIWEDTNGQVDIFVMGIGSDGTVFGVGQYLKSKNPNVKIYEVEPSESNITTKKSGAVAFL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
