SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g06131): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g06131): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g06131

Feature Type:gene_model
Chromosome:Gm01
Start:6027073
stop:6027783
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G61440AT Annotation by Michelle Graham. TAIR10: cysteine synthase C1 | chr3:22736550-22737792 FORWARD LENGTH=247 SoyBaseE_val: 9.00E-28ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006535GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process from serine SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009684GO-bp Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019499GO-bp Annotation by Michelle Graham. GO Biological Process: cyanide metabolic process SoyBaseN/AISS
GO:0019500GO-bp Annotation by Michelle Graham. GO Biological Process: cyanide catabolic process SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0032880GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein localization SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0051410GO-bp Annotation by Michelle Graham. GO Biological Process: detoxification of nitrogen compound SoyBaseN/AISS
GO:0080147GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell development SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004124GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine synthase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0030170GO-mf Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding SoyBaseN/AISS
GO:0050017GO-mf Annotation by Michelle Graham. GO Molecular Function: L-3-cyanoalanine synthase activity SoyBaseN/AISS
PTHR10314Panther PYRIDOXAL-5-PHOSPHATE DEPENDENT BETA FAMILY JGI ISS
PTHR10314:SF8Panther THREONINE DEHYDRATASE JGI ISS
PF00291PFAM Pyridoxal-phosphate dependent enzyme JGI ISS
UniRef100_A5YT86UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine synthase n=1 Tax=Glycine max RepID=A5YT86_SOYBN SoyBaseE_val: 3.00E-29ISS
UniRef100_A5YT86UniRef Annotation by Michelle Graham. Best UniRef hit: Cysteine synthase n=1 Tax=Glycine max RepID=A5YT86_SOYBN SoyBaseE_val: 3.00E-29ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g06131 not represented in the dataset

Glyma01g06131 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g051100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g06131.1   sequence type=CDS   gene model=Glyma01g06131   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTACAACAATTTTCAAACCCTGCCAATACTCTAGTGCATTTTGAAACAACATGGCCTGAGATATGGGAGGATACAAATGGACAAGTTGACATATTTGTTATGGGAATAGGTAGTGATGGCACAGTCTTTGGGGTTGGGCAATATCTTAAATCCAAAAATCCTAATGTTAAGATATATGAAGTGGAGCCAAGTGAAAGCAATATCACTACTAAAAAAAGTGGTGCGGTGGCATTTTTGTAA

>Glyma01g06131.1   sequence type=predicted peptide   gene model=Glyma01g06131   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLQQFSNPANTLVHFETTWPEIWEDTNGQVDIFVMGIGSDGTVFGVGQYLKSKNPNVKIYEVEPSESNITTKKSGAVAFL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo