|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G04660 | AT | Annotation by Michelle Graham. TAIR10: anaphase-promoting complex/cyclosome 2 | chr2:1624933-1629039 FORWARD LENGTH=865 | SoyBase | E_val: 4.00E-16 | ISS |
| GO:0006511 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
| GO:0007267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell-cell signaling | SoyBase | N/A | ISS |
| GO:0007276 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gamete generation | SoyBase | N/A | ISS |
| GO:0009561 | GO-bp | Annotation by Michelle Graham. GO Biological Process: megagametogenesis | SoyBase | N/A | ISS |
| GO:0009616 | GO-bp | Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing | SoyBase | N/A | ISS |
| GO:0010267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference | SoyBase | N/A | ISS |
| GO:0032875 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of DNA endoreduplication | SoyBase | N/A | ISS |
| GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
| GO:0051302 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell division | SoyBase | N/A | ISS |
| GO:0051510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth | SoyBase | N/A | ISS |
| GO:0000151 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ubiquitin ligase complex | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005819 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: spindle | SoyBase | N/A | ISS |
| GO:0031461 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cullin-RING ubiquitin ligase complex | SoyBase | N/A | ISS |
| GO:0004842 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0031625 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ubiquitin protein ligase binding | SoyBase | N/A | ISS |
| PTHR11932 | Panther | CULLIN | JGI | ISS | |
| PTHR11932:SF1 | Panther | CULLIN | JGI | ISS | |
| PF08672 | PFAM | Anaphase promoting complex (APC) subunit 2 | JGI | ISS | |
| UniRef100_G7JGA9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Anaphase-promoting complex subunit n=1 Tax=Medicago truncatula RepID=G7JGA9_MEDTR | SoyBase | E_val: 5.00E-31 | ISS |
| UniRef100_G7JGA9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Anaphase-promoting complex subunit n=1 Tax=Medicago truncatula RepID=G7JGA9_MEDTR | SoyBase | E_val: 5.00E-31 | ISS |
|
Glyma01g06121 not represented in the dataset |
Glyma01g06121 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g051000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g06121.1 sequence type=CDS gene model=Glyma01g06121 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTGAGACAAGTAAGAATGGAGCCAGTACTGGTTGTGCTCAGGAACTTCTAGGAGGTGAAGAGGAGGAAGAGAAATCTGTGGTATCGGTGGAAAATCAACTTCGTAAGGAAATGACTGTATATGAGAAATTTATCCTGGGGATGCTCACAAACTTTGGTAGCATGGCATTAGATCGAATTCACAATACTCGATTTCTTAGAATTGGCATTGCAGTTTGGAATGATTTTGATGTTTTCTTGCGCATTCCCACCTGCATTTGCTTTTGCTGCTGTGGTTCTATACTTGCTCATTGTCAATGTATTACGCAGACAAAGGCTTAG
>Glyma01g06121.1 sequence type=predicted peptide gene model=Glyma01g06121 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAETSKNGASTGCAQELLGGEEEEEKSVVSVENQLRKEMTVYEKFILGMLTNFGSMALDRIHNTRFLRIGIAVWNDFDVFLRIPTCICFCCCGSILAHCQCITQTKA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||