|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G18410 | AT | Annotation by Michelle Graham. TAIR10: transcription activators | chr5:6097456-6104783 REVERSE LENGTH=1282 | SoyBase | E_val: 1.00E-18 | ISS |
| GO:0000226 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0006342 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing | SoyBase | N/A | ISS |
| GO:0007020 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule nucleation | SoyBase | N/A | ISS |
| GO:0009860 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pollen tube growth | SoyBase | N/A | ISS |
| GO:0009965 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis | SoyBase | N/A | ISS |
| GO:0010090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis | SoyBase | N/A | ISS |
| GO:0016572 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone phosphorylation | SoyBase | N/A | ISS |
| GO:0030036 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0045010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin nucleation | SoyBase | N/A | ISS |
| GO:0051225 | GO-bp | Annotation by Michelle Graham. GO Biological Process: spindle assembly | SoyBase | N/A | ISS |
| GO:0051258 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein polymerization | SoyBase | N/A | ISS |
| GO:0051322 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anaphase | SoyBase | N/A | ISS |
| GO:0051567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0031209 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: SCAR complex | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PF05994 | PFAM | Cytoplasmic Fragile-X interacting family | JGI | ISS | |
| UniRef100_G7L2Z6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 121F-specific p53 inducible RNA n=1 Tax=Medicago truncatula RepID=G7L2Z6_MEDTR | SoyBase | E_val: 2.00E-18 | ISS |
| UniRef100_UPI000233A63F | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233A63F related cluster n=1 Tax=unknown RepID=UPI000233A63F | SoyBase | E_val: 2.00E-19 | ISS |
|
Glyma01g06091 not represented in the dataset |
Glyma01g06091 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g050600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g06091.1 sequence type=CDS gene model=Glyma01g06091 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCAAAGTGATTTTTTGCCAAATTTCATTCTCTGCAATACTACTCAACGTTTTATCAGATCATCAAGGGTTGTTCTTGTTCAAAAGCCATTTGTCCAGCCATTTCTACCCTCTGCGAAGCCTAGTTTCTATTGTGGTACTCAAATTACTTTGCTTGAACCAATGATTACAACATTACAAGACTCTTTGCCAAAATCATTTGTATAG
>Glyma01g06091.1 sequence type=predicted peptide gene model=Glyma01g06091 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MQSDFLPNFILCNTTQRFIRSSRVVLVQKPFVQPFLPSAKPSFYCGTQITLLEPMITTLQDSLPKSFV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||