|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G62410 | AT | Annotation by Michelle Graham. TAIR10: structural maintenance of chromosomes 2 | chr5:25056308-25062436 FORWARD LENGTH=1175 | SoyBase | E_val: 8.00E-23 | ISS |
| GO:0000911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation | SoyBase | N/A | ISS |
| GO:0006260 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication | SoyBase | N/A | ISS |
| GO:0006261 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication | SoyBase | N/A | ISS |
| GO:0006270 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication initiation | SoyBase | N/A | ISS |
| GO:0006275 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication | SoyBase | N/A | ISS |
| GO:0006306 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA methylation | SoyBase | N/A | ISS |
| GO:0006342 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing | SoyBase | N/A | ISS |
| GO:0006346 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing | SoyBase | N/A | ISS |
| GO:0008283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell proliferation | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0010267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference | SoyBase | N/A | ISS |
| GO:0010389 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle | SoyBase | N/A | ISS |
| GO:0016458 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gene silencing | SoyBase | N/A | ISS |
| GO:0016570 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone modification | SoyBase | N/A | ISS |
| GO:0031047 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA | SoyBase | N/A | ISS |
| GO:0031048 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA | SoyBase | N/A | ISS |
| GO:0034968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone lysine methylation | SoyBase | N/A | ISS |
| GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
| GO:0048449 | GO-bp | Annotation by Michelle Graham. GO Biological Process: floral organ formation | SoyBase | N/A | ISS |
| GO:0051276 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromosome organization | SoyBase | N/A | ISS |
| GO:0051322 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anaphase | SoyBase | N/A | ISS |
| GO:0051567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation | SoyBase | N/A | ISS |
| GO:0051607 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to virus | SoyBase | N/A | ISS |
| GO:0051726 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle | SoyBase | N/A | ISS |
| GO:0000796 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: condensin complex | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005694 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chromosome | SoyBase | N/A | ISS |
| GO:0005215 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transporter activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| UniRef100_I1M0W9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Structural maintenance of chromosomes protein n=1 Tax=Glycine max RepID=I1M0W9_SOYBN | SoyBase | E_val: 2.00E-42 | ISS |
| UniRef100_UPI0002339A1D | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002339A1D related cluster n=1 Tax=unknown RepID=UPI0002339A1D | SoyBase | E_val: 4.00E-52 | ISS |
|
Glyma01g06001 not represented in the dataset |
Glyma01g06001 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g049800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g06001.1 sequence type=CDS gene model=Glyma01g06001 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAATCTCTGTCAGAGAAGGTAGATGCACTTTCCCAGAATCTTGTGAGGGAAACGTCTGTACTAAATAATAAAGAAGACACTTTGAGGAGTGAAGAAGCCAACAAAGCAAATCTTGTTAAAAATATTGAAGAATTGAAGCATTCTGGAAAAGAGAAGTCCTCTGCTGTTAAAAAGGCTGAAGAGGGGGCAGCAGATCTGAAAAAGAAAGTTGATGAGCTCACAAAGAGTCTAGAGGAGCATGATAAAGAATACCAGGTAAAGGCTTAA
>Glyma01g06001.1 sequence type=predicted peptide gene model=Glyma01g06001 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKSLSEKVDALSQNLVRETSVLNNKEDTLRSEEANKANLVKNIEELKHSGKEKSSAVKKAEEGAADLKKKVDELTKSLEEHDKEYQVKA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||