Glyma01g05310 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g05310

Feature Type:	gene_model
Chromosome:	Gm01
Start:	4961752
stop:	4963489
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g05310

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G26945	AT	Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein \| chr1:9351571-9352474 FORWARD LENGTH=94	SoyBase	E_val: 5.00E-39	ISS
GO:0009416	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to light stimulus	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
PTHR12565	Panther	STEROL REGULATORY ELEMENT-BINDING PROTEIN	JGI		ISS
PTHR12565:SF8	Panther	UPSTREAM TRANSCRIPTION FACTOR	JGI		ISS
PF00010	PFAM	Helix-loop-helix DNA-binding domain	JGI		ISS
UniRef100_G7KCF8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH135 n=1 Tax=Medicago truncatula RepID=G7KCF8_MEDTR	SoyBase	E_val: 1.00E-41	ISS
UniRef100_I1J5N3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J5N3_SOYBN	SoyBase	E_val: 2.00E-57	ISS

Expression Patterns of Glyma01g05310

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g05310

Paralog	Evidence	Comments
Glyma02g02250	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g05310 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g044800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g05310

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g05310

Limit To All Plant Sequences

>Glyma01g05310.1   sequence type=CDS   gene model=Glyma01g05310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAGCAGAAGATCTCGTTCTAGACAATCCGGTGCTTCCGCTGAGATCACAGATGCTCAAATCACCGATCTCGTTTCGAAGTTACAACAACTTATCCCTGAGCTTCGTGCTAGGCGCTCCGACAAGGTTTCATCTGCTAAGGTATTGCAGGAGACATGCAACTACATAAAGAACTTGCACAGAGAGGTTGATGATCTAAGTGACCGATTATCGGAGCTTTTGGCTAACACAGACTCCAACAGTGCTCAAGCAGCCATTATTAGGAGCTTACTTATGTAA

Predicted protein sequences of Glyma01g05310

Limit To All Plant Sequences

>Glyma01g05310.1   sequence type=predicted peptide   gene model=Glyma01g05310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSRRSRSRQSGASAEITDAQITDLVSKLQQLIPELRARRSDKVSSAKVLQETCNYIKNLHREVDDLSDRLSELLANTDSNSAQAAIIRSLLM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain