SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g05170

Feature Type:gene_model
Chromosome:Gm01
Start:4850796
stop:4854700
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g05170
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G14360AT Annotation by Michelle Graham. TAIR10: UDP-galactose transporter 3 | chr1:4911362-4913029 REVERSE LENGTH=331 SoyBaseE_val: 0ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009553GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac development SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0030173GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to Golgi membrane SoyBaseN/AISS
GO:0030176GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to endoplasmic reticulum membrane SoyBaseN/AISS
GO:0005460GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-glucose transmembrane transporter activity SoyBaseN/AISS
GO:0015165GO-mf Annotation by Michelle Graham. GO Molecular Function: pyrimidine nucleotide-sugar transmembrane transporter activity SoyBaseN/AISS
KOG1581 KOG UDP-galactose transporter related protein JGI ISS
PTHR10778Panther UDP-GALACTOSE TRANSPORTER-RELATED JGI ISS
PTHR10778:SF10Panther UDP-GALACTOSE TRANSPORTER B1 (SLC35B1) JGI ISS
PF08449PFAM UAA transporter family JGI ISS
UniRef100_I1J5M6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J5M6_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q2HTW1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Solute carrier family protein n=2 Tax=Medicago truncatula RepID=Q2HTW1_MEDTR SoyBaseE_val: 0ISS

Expression Patterns of Glyma01g05170
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g05170
ParalogEvidenceComments
Glyma02g02330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g05170 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g044200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g05170
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g05170
>Glyma01g05170.1   sequence type=CDS   gene model=Glyma01g05170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGCTCACGGCGGCGGGCTCCGCCGAGTCCTTGTTCTCGCCTTCTGCGTCGCTGGAATCTGGTCGGCATACATCTACCAAGGCGTTCTGCAGGAAAATGTGTCGACGAAGCGATTCGACGGTGAAAGGTTCGAGCACCTTGCGTTTCTGAACTTGGCACAGAATGTGGTGTGTTTAATCTGGTCTTTTATAATGATAAAGATGTGGTCTAGTGGAAATTCTGGTGGTGCTCCTTGGTGGAGTTATTGGAGCGCTGGAATTACCAACACCATTGGTCCTGCTATGGGAATTGAAGCTTTGAAGTATATTAGTTACCCTGCTCAGGTGCTGGCGAAGTCCTCTAAAATGATTCCAGTTATGCTGATGGGTACTCTGGTATATGGTATAAGATACACTTTTCCAGAATACCTTTGTACTTTTCTTGTTGCTGGAGGGGTATCAACATTTGCACTTCTAAAGACTAGCTCAAAGACTATCAGCAAGCTGGCACATCCAAATGCTCCCCTTGGATATGGGTTGTGTTTCCTGAACCTTGCTTTTGATGGATTTACCAATGCAACTCAGGATTCTTTAAAAGCAAGGTATCCAAAAACAAGTGCTTGGGATATTATGCTGGGCATGAATTTATGGGGAACCATATACAATATGATTTACATGTTTGGATGGCCCCGTGCCAGTGGATTTGAGGCAGTTCGCTTTTGCCAGCAGCATCCAGAGGCAGCATGGGATATTTTTCTCTACTGCTGCTGTGGTGCTGTGGGCCAAAATTTCATCTTCTTGACTATAAGCCGGTTTGGCTCTTTGGCTAACACTACCATCACTACCACTCGCAAATTTGTAAGCATTGTGGTATCTTCTCTATTGAGTGGAAATCCCCTCTCTACAAAGCAATGGGGGTGTGTTTTCATGGTGTTCTCAGGATTGTCTTATCAGATCTACCTCAAGTGGCAGAAGTTGCAGAGATTGCAGAAGAAAAGAAAAGCTGTGTGA
Predicted protein sequences of Glyma01g05170
>Glyma01g05170.1   sequence type=predicted peptide   gene model=Glyma01g05170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAHGGGLRRVLVLAFCVAGIWSAYIYQGVLQENVSTKRFDGERFEHLAFLNLAQNVVCLIWSFIMIKMWSSGNSGGAPWWSYWSAGITNTIGPAMGIEALKYISYPAQVLAKSSKMIPVMLMGTLVYGIRYTFPEYLCTFLVAGGVSTFALLKTSSKTISKLAHPNAPLGYGLCFLNLAFDGFTNATQDSLKARYPKTSAWDIMLGMNLWGTIYNMIYMFGWPRASGFEAVRFCQQHPEAAWDIFLYCCCGAVGQNFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSTKQWGCVFMVFSGLSYQIYLKWQKLQRLQKKRKAV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo