Glyma01g04880 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g04880

Feature Type:	gene_model
Chromosome:	Gm01
Start:	4472510
stop:	4474524
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g04880

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G27050	AT	Annotation by Michelle Graham. TAIR10: homeobox protein 54 \| chr1:9393706-9394408 FORWARD LENGTH=205	SoyBase	E_val: 2.00E-52	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF00076	PFAM	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	JGI		ISS
UniRef100_G7K9R0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RCC1 and BTB domain-containing protein n=1 Tax=Medicago truncatula RepID=G7K9R0_MEDTR	SoyBase	E_val: 4.00E-89	ISS
UniRef100_I1J5K1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J5K1_SOYBN	SoyBase	E_val: 9.00E-159	ISS

Expression Patterns of Glyma01g04880

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g04880

Paralog	Evidence	Comments
Glyma02g02640	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g04880 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma01g04880

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g04880

Limit To All Plant Sequences

>Glyma01g04880.1   sequence type=CDS   gene model=Glyma01g04880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATATATTACTATTTTAGAGCAACACTCAGACAAGACCTTAGAAAAATCGAATTAAATTTGCACAGTAACATATTCCCTCACAACACAACAATGAGTCGCAAGAGAGACAGGTCAGCTTACTTTTCCCGCCACGACGCCGCCAAGCGCCGCCTCCCCTTGCCGGAGCCCGCGGAGGAGGAGACGCCTACGATGAGACCGGCGCCGCCGTCCGCGGTGGTCGTGATGGGCCTCCCCCAGGACTGCTCCGTCCTCGATCTCAAGTCCCGATTCGAGATCTACGGCGCCATCTCCCGCATCCGCATCGACCGCGACGCCGTCGGATACATCACCTACCGGACCAAGGACTCCGCCGACGCTGCCATCGCCGCCGGCCTCGACCCCACCTTCGGAATCACCGTTAACTCTAAAATGGTTCAGGTGTTGTGGGCAACGGACCCTCTAGCCATGTGGAGGGAAGGAGTTGGTAATAGCAGGAACAAAGGTTCTATGTCAAAGCTTGTGCGTGCTGAGGTACCTTTGAGCAAGCATGGAAGAGGTAACAGACTTGCTTCACCCATAGGGAATACCAAACTTAGCGAGGCTAGCTCAGGTAGCTCAGTTTTAGAAGTGTCTTTCAAGGGCAGAGAAATTGTTGCTTATGATGATATCCTCTGA

Predicted protein sequences of Glyma01g04880

Limit To All Plant Sequences

>Glyma01g04880.1   sequence type=predicted peptide   gene model=Glyma01g04880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIYYYFRATLRQDLRKIELNLHSNIFPHNTTMSRKRDRSAYFSRHDAAKRRLPLPEPAEEETPTMRPAPPSAVVVMGLPQDCSVLDLKSRFEIYGAISRIRIDRDAVGYITYRTKDSADAAIAAGLDPTFGITVNSKMVQVLWATDPLAMWREGVGNSRNKGSMSKLVRAEVPLSKHGRGNRLASPIGNTKLSEASSGSSVLEVSFKGREIVAYDDIL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain