SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma01g04616

Feature Type:gene_model
Chromosome:Gm01
Start:4234778
stop:4236309
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G29080AT Annotation by Michelle Graham. TAIR10: phytochrome-associated protein 2 | chr4:14323665-14325213 REVERSE LENGTH=305 SoyBaseE_val: 2.00E-58ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006417GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of translation SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0048438GO-bp Annotation by Michelle Graham. GO Biological Process: floral whorl development SoyBaseN/AISS
GO:0048439GO-bp Annotation by Michelle Graham. GO Biological Process: flower morphogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PF02309PFAM AUX/IAA family JGI ISS
UniRef100_G7L869UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-responsive protein (Aux/IAA) n=1 Tax=Medicago truncatula RepID=G7L869_MEDTR SoyBaseE_val: 1.00E-86ISS
UniRef100_UPI00023370F3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023370F3 related cluster n=1 Tax=unknown RepID=UPI00023370F3 SoyBaseE_val: 1.00E-138ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g04616 not represented in the dataset

Glyma01g04616 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g039300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g04616.1   sequence type=CDS   gene model=Glyma01g04616   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAATGGAATGGTGGTGGATCTGAAAAAAGATGTTGCTACCTTGTTTTGTCCAACTTCAAGGGGTGTTGTTCCTGTTAGTGTTGCCAAGTCTGTCACTTTCACTGCAACAGACTGCACCAACCAACCAACTGCTTTGGGTGCTTCTGTTCTCAGGGAAACTATTCCACACTCTCCAAAACCATTACATGAGAATAAGCCCCAGATTTCTGTTGCAACTGCAAAGGCGCAAGTTGTGGGATGGCCACCAATCCGTTCATTCAGGAAGAACTCAATGGCTTCTCAGCCTCAGAAGAATGATGTTGCTGCTAATGCAGAAGCCAAGTCTGGATGCCTTTATGTTAAAGTCAACATGGAAGGCTCCCCATACTTAAGGAAAGTGGATCTGAATAGTTTTACCACTTACAAGGACCTCTCTTTGGCACTTGAAAAGATGTTTAGTTGTTTTACACTCAGTCAATGTGGCTCATATGGGGTTTCTAGTCGGGAAAATTTAAGTGAAAGTAGATTGATGGATCTCCTTCATGGTTCAAAATATGTTCTTATCTATGAAGACAAGGATGGAGATTGGATGCTAGTTGGTGATGTTCTGTGGGAGTAA

>Glyma01g04616.1   sequence type=predicted peptide   gene model=Glyma01g04616   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MENGMVVDLKKDVATLFCPTSRGVVPVSVAKSVTFTATDCTNQPTALGASVLRETIPHSPKPLHENKPQISVATAKAQVVGWPPIRSFRKNSMASQPQKNDVAANAEAKSGCLYVKVNMEGSPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVSSRENLSESRLMDLLHGSKYVLIYEDKDGDWMLVGDVLWE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo