SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g04450

Feature Type:gene_model
Chromosome:Gm01
Start:3990477
stop:3991986
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g04450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10460AT Annotation by Michelle Graham. TAIR10: germin-like protein 7 | chr1:3439578-3440231 REVERSE LENGTH=217 SoyBaseE_val: 2.00E-82ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0030145GO-mf Annotation by Michelle Graham. GO Molecular Function: manganese ion binding SoyBaseN/AISS
GO:0045735GO-mf Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity SoyBaseN/AISS
PF00190PFAM Cupin JGI ISS
UniRef100_C7S8B9UniRef Annotation by Michelle Graham. Best UniRef hit: Germin-like protein 5 n=1 Tax=Glycine max RepID=C7S8B9_SOYBN SoyBaseE_val: 1.00E-156ISS
UniRef100_C7S8B9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Germin-like protein 5 n=1 Tax=Glycine max RepID=C7S8B9_SOYBN SoyBaseE_val: 1.00E-156ISS

Expression Patterns of Glyma01g04450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g04450
ParalogEvidenceComments
Glyma02g03100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g04450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g037800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g04450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g04450
>Glyma01g04450.1   sequence type=CDS   gene model=Glyma01g04450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAACCCATTTTCACTCTCTCCCATTGATTTTTTTGTTCACCCTTTCCCTTCTATTGGGTAAAACCCGACCCGACCCTGATCCACTTCAAGATTATTGTGTAGCAGATAGCAAAAGTGAATTTTTCATTAATGGGGTGCCTTGCATTGACCCAGATAAAGTTTCCTCCTCCCATTTTGTCACATCTGCTTTATCAAAAACTGGCAACACTAGCAACCAATTTGGCTTCAGTGTCACAGCCACCACCACTGCTAATCTTCCTGGGCTTAACACCTTGGGCCTGGTACTGGTCCGGGTTGACATAGCGGGCAATGGGATCGTGCCACCTCACTCACATCCACGGGCCTCGGAAGTGACAACTTGCCTTAAGGGCATGCTTCTTGTGGGCTTTGTTGACACAAGTAACCGTGTCTTTACCCAGAACTTGAGGCCCGGTGAGTCGTTTGTGTTCCCAAAGGGCCTGGTCCACTTCTTGTTCAATAGTGATTCCAGGGAACCAGCAATTGCCATATCCGGTCTCAATAGTCAGAACCCAGGTGCACAAATTGCATCACTTGCAACATTTGCTAGCAAGCCTCCAATCCCTGATGACATTCTTAAGAAGGCTTTCCAAATTTCCAAAGGAGAAGTGGAAACTATTCGTAGAAACCTTGGAGGATGA
Predicted protein sequences of Glyma01g04450
>Glyma01g04450.1   sequence type=predicted peptide   gene model=Glyma01g04450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRTHFHSLPLIFLFTLSLLLGKTRPDPDPLQDYCVADSKSEFFINGVPCIDPDKVSSSHFVTSALSKTGNTSNQFGFSVTATTTANLPGLNTLGLVLVRVDIAGNGIVPPHSHPRASEVTTCLKGMLLVGFVDTSNRVFTQNLRPGESFVFPKGLVHFLFNSDSREPAIAISGLNSQNPGAQIASLATFASKPPIPDDILKKAFQISKGEVETIRRNLGG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo