SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g04421

Feature Type:gene_model
Chromosome:Gm01
Start:3965516
stop:3967099
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g04421
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G59940AT Annotation by Michelle Graham. TAIR10: response regulator 3 | chr1:22065894-22066895 REVERSE LENGTH=231 SoyBaseE_val: 1.00E-69ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010161GO-bp Annotation by Michelle Graham. GO Biological Process: red light signaling pathway SoyBaseN/AISS
GO:0042752GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of circadian rhythm SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0000156GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity SoyBaseN/AISS
PTHR26402Panther RESPONSE REGULATOR OF TWO-COMPONENT SYSTEM JGI ISS
PTHR26402:SF57Panther JGI ISS
PF00072PFAM Response regulator receiver domain JGI ISS
UniRef100_B0YGG5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Type A response regulator RR1 n=1 Tax=Phaseolus vulgaris RepID=B0YGG5_PHAVU SoyBaseE_val: 1.00E-110ISS
UniRef100_UPI00023370EBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023370EB related cluster n=1 Tax=unknown RepID=UPI00023370EB SoyBaseE_val: 7.00E-173ISS

Expression Patterns of Glyma01g04421
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g04421 not represented in the dataset
Glyma01g04421 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g04421
ParalogEvidenceComments
Glyma02g03140 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g04421 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g037500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g04421
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g04421
>Glyma01g04421.1   sequence type=CDS   gene model=Glyma01g04421   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACACGGACGGTGTCGTTTCGTTCAACCATGTCTCGCCGGAGGATTCCCACGAGGTTCATGTCTTGGCCGTCGACGACAGCCTCGTTGATCGAAAGGTCATTGAGCGCTTGCTCAAAATCTCAGCTTGTAAAGTTACGGCTGTGGATAGTGGAATCAGAGCACTGCAATTTCTGGGGCTGGATGAGCAGAGAAGGACCTCTGAATCTGATGGTTTTGTCCCGGATTTGAAGGTGGATCTAATTATCACAGACTACTGCATGCCCGAAATGACCGGTTACGAGTTGCTCAAGAAAATCAAGGAATCGACCATGTTCAGAGAAATTCCAGTAGTGATCATGTCTTCCGAAAACATTTTGCCGCGCATAGACAGATGTTTGGAGGAAGGTGCAGAGGATTTCATAGTGAAGCCAGTGAAATTATCTGATGTAAAACGGTTAAAGGGTTACTTGACACCAAAAGAGGTTATTAAGGTTGACAGAAGAAGTGATGGTTATGTTAACGGTGGCTGCAAAGGTGGTGATGGTGGTGGTGGTGGTGGTGTGGAGATAAACAACAACAAAAGGAAGCTGGAAGAGCAAGACACATCTGACGTGTCAACATCTCCACCGTCCACTTCTACACTTTCATCATCACCCTCCGTTTCTTCACCATCACCGTCATCTTCTCCTACCTCTTCACCCAGCGTGCTTGCTTCTCCGATCAGACGGCTTAAAATGACCAGCACCGATTGA
Predicted protein sequences of Glyma01g04421
>Glyma01g04421.1   sequence type=predicted peptide   gene model=Glyma01g04421   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDTDGVVSFNHVSPEDSHEVHVLAVDDSLVDRKVIERLLKISACKVTAVDSGIRALQFLGLDEQRRTSESDGFVPDLKVDLIITDYCMPEMTGYELLKKIKESTMFREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYLTPKEVIKVDRRSDGYVNGGCKGGDGGGGGGVEINNNKRKLEEQDTSDVSTSPPSTSTLSSSPSVSSPSPSSSPTSSPSVLASPIRRLKMTSTD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo