SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g03540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g03540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g03540

Feature Type:gene_model
Chromosome:Gm01
Start:3063217
stop:3065991
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G05670AT Annotation by Michelle Graham. TAIR10: signal recognition particle binding | chr5:1695916-1697534 REVERSE LENGTH=260 SoyBaseE_val: 7.00E-136ISS
GO:0006302GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair SoyBaseN/AISS
GO:0006312GO-bp Annotation by Michelle Graham. GO Biological Process: mitotic recombination SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0009560GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016570GO-bp Annotation by Michelle Graham. GO Biological Process: histone modification SoyBaseN/AISS
GO:0031507GO-bp Annotation by Michelle Graham. GO Biological Process: heterochromatin assembly SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0045787GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell cycle SoyBaseN/AISS
GO:0046520GO-bp Annotation by Michelle Graham. GO Biological Process: sphingoid biosynthetic process SoyBaseN/AISS
GO:0048449GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ formation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005047GO-mf Annotation by Michelle Graham. GO Molecular Function: signal recognition particle binding SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0090 KOG Signal recognition particle receptor, beta subunit (small G protein superfamily) JGI ISS
PTHR19326Panther SIGNAL RECOGNITION PARTICLE RECEPTOR BETA SUBUNIT RELATED JGI ISS
PF09439PFAM Signal recognition particle receptor beta subunit JGI ISS
UniRef100_G7JJT7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Signal recognition particle receptor subunit beta n=1 Tax=Medicago truncatula RepID=G7JJT7_MEDTR SoyBaseE_val: 7.00E-155ISS
UniRef100_I1J575UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J575_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g03540 not represented in the dataset

Glyma01g03540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g04110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g029000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g03540.1   sequence type=CDS   gene model=Glyma01g03540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAGTTGGAGCAGTGGAAGGAACAACTTTCTCACTTCGCTAACCTAGCTTTGGATCGTCTTCTCGAGGTTCCTCCGAATCAGCTCTACGCAGCTGCTGCAATCGTGATTTTCACAACGCTGCTTCTTCTCTCAATTCGGTTGTTCAAGCGTGCGAAGTCAAACACTGTTGTGTTGGCCGGGCTCAGCGGGAGTGGAAAAACTGTTATCTTCTATCAGCTTAGGGATGGCTCTACTCATCAGGGTACTGTTACATCAATGGAGCCTAATGAAGGCACTTTTATTCTTCACAACGAGAAAACAAGGAAGGGCAAGATAAAACCTGTTCATGTTGTTGATGTTCCTGGGCATTCTCGGCTTCGACCCAAACTGGATGAGTACTTGCCTCAAGCAGCTGGGATAGTTTTTGTGGTAGATGCTTTGGACTTTTTACCAAACTGCCGTGCTGCTTCAGAGTACCTTTATGATCTATTGACTAAAGGAAGTGTTGTGAGGAAGAAGATTCCAGTGCTTATTCTCTGCAACAAAACAGACAAAGTCACTGCTCATACTAAAGAGTTTATCCGAAAACAGATGGAGAAGGAAATAGACAAATTACGGGCATCAAGGAGTGCAATATCAGCAGCTGACATTGCAAATGAGTTCACCCTGGGGGTACCCGGTGAGCCATTTTTTTTTACCCAGTGCTCTAACAAAGTGACAACTGCAGATGCTTCTGGTTTAACTGGGGAAATATCTCAGCTGGAAGAGTTTATCAGAGAACATGTAAAGCAATAG

>Glyma01g03540.1   sequence type=predicted peptide   gene model=Glyma01g03540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEELEQWKEQLSHFANLALDRLLEVPPNQLYAAAAIVIFTTLLLLSIRLFKRAKSNTVVLAGLSGSGKTVIFYQLRDGSTHQGTVTSMEPNEGTFILHNEKTRKGKIKPVHVVDVPGHSRLRPKLDEYLPQAAGIVFVVDALDFLPNCRAASEYLYDLLTKGSVVRKKIPVLILCNKTDKVTAHTKEFIRKQMEKEIDKLRASRSAISAADIANEFTLGVPGEPFFFTQCSNKVTTADASGLTGEISQLEEFIREHVKQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo