SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g03430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g03430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g03430

Feature Type:gene_model
Chromosome:Gm01
Start:2918597
stop:2922169
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G23360AT Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr1:8295421-8296893 REVERSE LENGTH=261 SoyBaseE_val: 1.00E-116ISS
GO:0042372GO-bp Annotation by Michelle Graham. GO Biological Process: phylloquinone biosynthetic process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
GO:0052624GO-mf Annotation by Michelle Graham. GO Molecular Function: 2-phytyl-1,4-naphthoquinone methyltransferase activity SoyBaseN/AISS
KOG1540 KOG Ubiquinone biosynthesis methyltransferase COQ5 JGI ISS
PTHR10108Panther METHYLTRANSFERASE JGI ISS
PTHR10108:SF236Panther SUBFAMILY NOT NAMED JGI ISS
PF01209PFAM ubiE/COQ5 methyltransferase family JGI ISS
UniRef100_G7K058UniRef Annotation by Michelle Graham. Most informative UniRef hit: Menaquinone biosynthesis methyltransferase ubiE n=1 Tax=Medicago truncatula RepID=G7K058_MEDTR SoyBaseE_val: 6.00E-142ISS
UniRef100_I1J566UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J566_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g03430 not represented in the dataset

Glyma01g03430 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g04200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g028200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g03430.1   sequence type=CDS   gene model=Glyma01g03430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATATAAAGAATCGATGTGGAAAGCGCAGAACATGCCACATGGCGATGACGTTTGTTCCTTCTTCAACTTCTTCCACTTTCCGACCAACGTTGATTCGCTGCGCCAGCGCCAATGAGCGGCAGGCGCTGTTTAGCCGCATTGCTCCTGTCTATGATAACCTGAATGATTTGCTGAGCCTTGGGCAACACCGGATTTGGAAGAGAATGGCAGTGTCCTGGACTGGAGCGAAAATGGGAGACTGTGTGTTGGATGTTTGCTGTGGAAGTGGGGACTTATCCTTTCTCTTGTCCGACAAAGTTGGCTCTCATGGCAAGGTGATTGGTCTTGATTTCTCGAAGGATCAGCTATCCTTTGCCTTATCTCGGCAGCAATCACTTTCAAAGAATTGCTTCATGAATATCGAGTGGGTTGAAGGTGATGCTCTTGACTTGCCATTTTCTGATGGTTGGTTTGATGCTATCACTATGGGCTATGGTCTTCGAAATGTGGTTGATAAGCAAAAGGCCATGCAGGAAATTTTCCGCGTCCTAAAAACTGGCTCTACAGTATCTATCCTGGATTTTAATAAAAGCAATGAGTTGCTAACTTCTGCAGTTACGGAATGGATGATTGACAATATTGTTGTCCCTGTTGCCACTGGTTATGGTCTTTCAGAGGAATACAGATACCTCAAACGTTCAATAAGAGAATTTTTAACAGGGAAGGAGTTGGAGAAACTTGCCTTGGGAGTTGGATTTTCTGCTGCTCGACATTATGAGATTGGTGGAGGCCTCATGGGGTGTTTGGTAGCTAAGCGTTAG

>Glyma01g03430.1   sequence type=predicted peptide   gene model=Glyma01g03430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNIKNRCGKRRTCHMAMTFVPSSTSSTFRPTLIRCASANERQALFSRIAPVYDNLNDLLSLGQHRIWKRMAVSWTGAKMGDCVLDVCCGSGDLSFLLSDKVGSHGKVIGLDFSKDQLSFALSRQQSLSKNCFMNIEWVEGDALDLPFSDGWFDAITMGYGLRNVVDKQKAMQEIFRVLKTGSTVSILDFNKSNELLTSAVTEWMIDNIVVPVATGYGLSEEYRYLKRSIREFLTGKELEKLALGVGFSAARHYEIGGGLMGCLVAKR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo