|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G54640 | AT | Annotation by Michelle Graham. TAIR10: Histone superfamily protein | chr5:22196540-22197279 FORWARD LENGTH=130 | SoyBase | E_val: 2.00E-82 | ISS |
| GO:0006334 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleosome assembly | SoyBase | N/A | ISS |
| GO:0009294 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA mediated transformation | SoyBase | N/A | ISS |
| GO:0009611 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to wounding | SoyBase | N/A | ISS |
| GO:0009617 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to bacterium | SoyBase | N/A | ISS |
| GO:0000786 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleosome | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005730 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleolus | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| KOG1756 | KOG | Histone 2A | JGI | ISS | |
| PTHR23430 | Panther | HISTONE H2A | JGI | ISS | |
| PF00125 | PFAM | Core histone H2A/H2B/H3/H4 | JGI | ISS | |
| UniRef100_C6SZZ5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Histone H2A n=1 Tax=Glycine max RepID=C6SZZ5_SOYBN | SoyBase | E_val: 2.00E-89 | ISS |
| UniRef100_C6SZZ5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Histone H2A n=1 Tax=Glycine max RepID=C6SZZ5_SOYBN | SoyBase | E_val: 2.00E-89 | ISS |
|
Glyma01g02720 not represented in the dataset |
Glyma01g02720 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g022100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g02720.1 sequence type=CDS gene model=Glyma01g02720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCGGGTAGAGGCAAAACCCTAGGATCCAGCGCCGCTAAGAAGGCCACCTCAAGGAGCAGCAAAGCCGGCCTCCAATTCCCCGTCGGTCGTATCGCCAGGTTCCTCAAGGCCGGAAAGTACGCCGAGCGCGTCGGCGCCGGAGCCCCCGTCTACCTCGCCGCCGTTCTCGAATATCTCGCTGCTGAGGTTTTGGAATTGGCTGGAAACGCTGCGAGAGATAACAAGAAGACTCGAATTGTTCCACGCCACATCCAATTGGCGGTGAGGAACGACGAAGAGTTGAGCAAGCTTCTAGGAGATGTTACCATTGCTAACGGCGGTGTTATGCCTAACATTCACAACCTTCTTCTTCCCAAGAAGGCTGGGGGCTCATCCAAGGGTGCTGCTGCTGACGATGACTCTTAA
>Glyma01g02720.1 sequence type=predicted peptide gene model=Glyma01g02720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAGRGKTLGSSAAKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKKAGGSSKGAAADDDS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||