SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g02040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g02040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g02040

Feature Type:gene_model
Chromosome:Gm01
Start:1558850
stop:1560186
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g02040
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G32340AT Annotation by Michelle Graham. TAIR10: NDR1/HIN1-like 8 | chr1:11663462-11666037 REVERSE LENGTH=688 SoyBaseE_val: 3.00E-17ISS
GO:0006487GO-bp Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009610GO-bp Annotation by Michelle Graham. GO Biological Process: response to symbiotic fungus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR11685Panther ARIADNE RING ZINC FINGER JGI ISS
PTHR11685:SF61Panther SUBFAMILY NOT NAMED JGI ISS
PF05773PFAM RWD domain JGI ISS
UniRef100_G7KDN8UniRef Annotation by Michelle Graham. Best UniRef hit: E3 ubiquitin-protein ligase RNF14 n=1 Tax=Medicago truncatula RepID=G7KDN8_MEDTR SoyBaseE_val: 1.00E-39ISS
UniRef100_G7KDN8UniRef Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase RNF14 n=1 Tax=Medicago truncatula RepID=G7KDN8_MEDTR SoyBaseE_val: 1.00E-39ISS

Expression Patterns of Glyma01g02040
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g02040 not represented in the dataset
Glyma01g02040 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g02040
ParalogEvidenceComments
Glyma09g33906 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g02040 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g02040
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g02040
>Glyma01g02040.1   sequence type=CDS   gene model=Glyma01g02040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGACTCCTCCTTCACTCCAACCCTTCTTCTCCTCACCACAACAATTTGGGCCCACCAAACCACCCGAACTTGCAATACTGTGTCGCCAACAAGCCCGAACCGGGTCCTTCTTCCAAATCTCACTCCGTGGTAGAGGAGGATGTGATTGCAAGATGAGAAGTATTATGGCACTTGTGGTGGAGTCAATTTATGGAGAAAACATTGTCAGCCTTGAGAGGTGGAAAGGCCTGCGTTGTTTACAGATACATATACACGTTGATGTTTTGGGTGAAATTGCCATCACTGCTAACTTGAACTTTCTCAATCAACTTGAGACTGTAAGCAGCAATTTAGATGAGTTCTTATACACTTTCAAAGTCCAATATATACCACCAATTGTTATGACGTGTTTATTACCTAAGTCGTACCCAAGCGACCAACCACCTATTTTTACACTCTGTTAG
Predicted protein sequences of Glyma01g02040
>Glyma01g02040.1   sequence type=predicted peptide   gene model=Glyma01g02040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KTPPSLQPFFSSPQQFGPTKPPELAILCRQQARTGSFFQISLRGRGGCDCKMRSIMALVVESIYGENIVSLERWKGLRCLQIHIHVDVLGEIAITANLNFLNQLETVSSNLDEFLYTFKVQYIPPIVMTCLLPKSYPSDQPPIFTLC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo