Glyma01g00780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g00780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g00780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g00780

Feature Type:	gene_model
Chromosome:	Gm01
Start:	441914
stop:	445194
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g00780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G29170	AT	Annotation by Michelle Graham. TAIR10: Mnd1 family protein \| chr4:14382985-14385128 FORWARD LENGTH=230	SoyBase	E_val: 3.00E-125	ISS
GO:0000724	GO-bp	Annotation by Michelle Graham. GO Biological Process: double-strand break repair via homologous recombination	SoyBase	N/A	ISS
GO:0006261	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication	SoyBase	N/A	ISS
GO:0006275	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication	SoyBase	N/A	ISS
GO:0006302	GO-bp	Annotation by Michelle Graham. GO Biological Process: double-strand break repair	SoyBase	N/A	ISS
GO:0006306	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA methylation	SoyBase	N/A	ISS
GO:0006312	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitotic recombination	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007062	GO-bp	Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion	SoyBase	N/A	ISS
GO:0007129	GO-bp	Annotation by Michelle Graham. GO Biological Process: synapsis	SoyBase	N/A	ISS
GO:0007131	GO-bp	Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination	SoyBase	N/A	ISS
GO:0009553	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac development	SoyBase	N/A	ISS
GO:0009555	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen development	SoyBase	N/A	ISS
GO:0009560	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation	SoyBase	N/A	ISS
GO:0010212	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ionizing radiation	SoyBase	N/A	ISS
GO:0010332	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gamma radiation	SoyBase	N/A	ISS
GO:0016444	GO-bp	Annotation by Michelle Graham. GO Biological Process: somatic cell DNA recombination	SoyBase	N/A	ISS
GO:0022402	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell cycle process	SoyBase	N/A	ISS
GO:0031047	GO-bp	Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA	SoyBase	N/A	ISS
GO:0042138	GO-bp	Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation	SoyBase	N/A	ISS
GO:0042991	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription factor import into nucleus	SoyBase	N/A	ISS
GO:0043687	GO-bp	Annotation by Michelle Graham. GO Biological Process: post-translational protein modification	SoyBase	N/A	ISS
GO:0045132	GO-bp	Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0051726	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG3433	KOG	Protein involved in meiotic recombination/predicted coiled-coil protein	JGI		ISS
PF03962	PFAM	Mnd1 family	JGI		ISS
UniRef100_B9RKD6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Meiotic coiled-coil protein, putative n=1 Tax=Ricinus communis RepID=B9RKD6_RICCO	SoyBase	E_val: 2.00E-128	ISS
UniRef100_I1J4E4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J4E4_SOYBN	SoyBase	E_val: 6.00E-158	ISS

Expression Patterns of Glyma01g00780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g00780 not represented in the dataset	Glyma01g00780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g00780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g004700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g00780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g00780

Limit To All Plant Sequences

>Glyma01g00780.1   sequence type=CDS   gene model=Glyma01g00780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAAAGAAAAGGGGCCTCTCATTGGAAGAGAAGCGCGAGAAGATGCTTCAAATCTTTTACGAGTCGCAAGACTTCTACCTGCTTAAGGAGCTCGAGAAGATGGGTCCCAGGAAGGGTGTCATTTCTCAGTCTGTGAAAGATGTGGTCCAAAGTTTAGTGGATGATGACCTTGTTTCCAAAGATAAAATAGGAACTTCTGTGTACTTTTGGAGTCTACCTAGCTGTGCTGGTAATCAGCTTAGGAATGTGTCCCGCAAACTTGATTCTGATCTAGAAAGCAGTAAGAAGCGGCATGCCCAACTTGTTGATCAATGTGAGGAGCTAAAGAAGGGGCGAGAGGAATCTGATGAAAGAGTGGAGGCCATTGCAGATCTAAAAGCCATTGAGCAAAAGCATAATGAATTGAAGGATGAGTTGGCAAAGTATAAAGATAATGATCCGGCTGCCTTTGAAGCAATGAAGGAAGCAATTGCAGTTGCCCATGCATCGGCAAACAGATGGACAGACAACATTTTCACCCTGAGGCAATGGTGTTCGAACAATTTCCCACAGGCTAAGGAACAACTTGAAAACTTGTACAAGGAGGTTGGTATAACAGATGATTTTGACTATTTGGAGTTAGCACCTGTCCCACTCAAAACAGTTGCTGATTAA

Predicted protein sequences of Glyma01g00780

Limit To All Plant Sequences

>Glyma01g00780.1   sequence type=predicted peptide   gene model=Glyma01g00780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKKRGLSLEEKREKMLQIFYESQDFYLLKELEKMGPRKGVISQSVKDVVQSLVDDDLVSKDKIGTSVYFWSLPSCAGNQLRNVSRKLDSDLESSKKRHAQLVDQCEELKKGREESDERVEAIADLKAIEQKHNELKDELAKYKDNDPAAFEAMKEAIAVAHASANRWTDNIFTLRQWCSNNFPQAKEQLENLYKEVGITDDFDYLELAPVPLKTVAD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain