Glyma01g00341 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g00341): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g00341): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g00341

Feature Type:	gene_model
Chromosome:	Gm01
Start:	143353
stop:	155722
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g00341

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G58100	AT	Annotation by Michelle Graham. TAIR10: unknown protein; INVOLVED IN: pollen exine formation; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 8 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G28720.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). \| chr5:23507828-23514863 FORWARD LENGTH=945	SoyBase	E_val: 2.00E-77	ISS
GO:0010584	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen exine formation	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
UniRef100_I1KZF7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZF7_SOYBN	SoyBase	E_val: 5.00E-136	ISS

Expression Patterns of Glyma01g00341

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g00341 not represented in the dataset	Glyma01g00341 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g00341 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g000700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g00341

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g00341

Limit To All Plant Sequences

>Glyma01g00341.1   sequence type=CDS   gene model=Glyma01g00341   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAATGGATTTTCGCAAATTCAGCGTCAAACGTCAGTGTTTACCGTGGCAGCTCCAACTCGTCATCTCTATTCTTCTGTTCTTAGCAGTTAGTTCACTTGGATCACCTATTGAAACTCGCAAAAGTGGCAGATCATCTGTATTCTCACTTTTTAATCTCAAAGAAAAGAGTCGATTTTGGAGTGAGGATGTTATACACAATGATTTTGATGATTTAAAGTTTTCAAGCCATGGAAAACTAAGTGCATTTAATTATACCAATGCAGGTAACATTGCTAACTATCTAAAGCTTCAGGAAGTTGATTCCATCCACCTTCCAGTTCCTATGAATTTTATATTTATAGGATTTGAAGGGAAGGGCAGCCATGAATTCAAGCTTCTTCCAGAAGAAATTGAGCGTTGGTTTACAAAAATTGATCATGTCTTTGAACACACTCGGATTCGACATGAAGAAGTTCTAATTCCATTTTACAAAACCAACATGGATAAAATGCGATGGCACCACCTTCCTGTCGTTAGTCACATAAATTACAATTTTTCTGTTCATGCTATTGAAATGGGAGAGAAGGTTACTTCCATAATTGAGCATGCCATAAATGTGTTTGGCCGCAAGGATGATCCAGTTGGGAGCCGGTAA

Predicted protein sequences of Glyma01g00341

Limit To All Plant Sequences

>Glyma01g00341.1   sequence type=predicted peptide   gene model=Glyma01g00341   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKMDFRKFSVKRQCLPWQLQLVISILLFLAVSSLGSPIETRKSGRSSVFSLFNLKEKSRFWSEDVIHNDFDDLKFSSHGKLSAFNYTNAGNIANYLKLQEVDSIHLPVPMNFIFIGFEGKGSHEFKLLPEEIERWFTKIDHVFEHTRIRHEEVLIPFYKTNMDKMRWHHLPVVSHINYNFSVHAIEMGEKVTSIIEHAINVFGRKDDPVGSR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain