Glyma0022s00346

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma0022s00346): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma0022s00346): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma0022s00346

Feature Type:	gene_model
Chromosome:	scaffold_22
Start:	563727
stop:	567494
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma0022s00346

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G56240	AT	Annotation by Michelle Graham. TAIR10: copper chaperone \| chr3:20863460-20864402 REVERSE LENGTH=121	SoyBase	E_val: 8.00E-11	ISS
GO:0000302	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to reactive oxygen species	SoyBase	N/A	ISS
GO:0006598	GO-bp	Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006816	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium ion transport	SoyBase	N/A	ISS
GO:0006878	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular copper ion homeostasis	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0007568	GO-bp	Annotation by Michelle Graham. GO Biological Process: aging	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009698	GO-bp	Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process	SoyBase	N/A	ISS
GO:0009805	GO-bp	Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process	SoyBase	N/A	ISS
GO:0009963	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0030001	GO-bp	Annotation by Michelle Graham. GO Biological Process: metal ion transport	SoyBase	N/A	ISS
GO:0042398	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0016531	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper chaperone activity	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
UniRef100_Q9SE03	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Copper chaperone homolog CCH n=1 Tax=Glycine max RepID=Q9SE03_SOYBN	SoyBase	E_val: 1.00E-08	ISS
UniRef100_UPI000233D49E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D49E related cluster n=1 Tax=unknown RepID=UPI000233D49E	SoyBase	E_val: 5.00E-29	ISS

Expression Patterns of Glyma0022s00346

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma0022s00346 not represented in the dataset	Glyma0022s00346 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma0022s00346 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g263900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma0022s00346

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma0022s00346

Limit To All Plant Sequences

>Glyma0022s00346.1   sequence type=CDS   gene model=Glyma0022s00346   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGACCCACATACAGTGATATGGGGTGCAAACTAGCCCTTGAAGACAAAAAAAGAGTCGCATTTAGGAGGAGGCATAGGCATGAACATGTTGATGCAACAAGGCATGCCAAACCTTGCAATTGTTCAAGTTTGGCCTCTCAGCAACAAAAAGGTCACAGAACCAAAGAGAAACTAATTCAATTCCTTTGTAGTAGTTGCTTGCTTTGTGTATGTTGCCCTTTAGCCTGTGTCTGTTGTTTCATCAAGCTACCATGCAGAATCTGTCATCAAGCACTGAGGTGTGCCCAGAAATGGGCATGTTATGGATCAAAGAATAATAGGACCGTTGTCCTCAAAGTTGGTATGTCATGTCAAGGGTGTGCTGGAGCAGTAAACAGGATTTTGGGAAAAATGGAAGGTATTTTTATTCCTGCAAGCTATCTCTACTATCAGATCCAAAATGAAAATGATCTAGTAATTGTAGCAATGTATTTTAATTCCAACATTCTAACTCCAACCATCAACTATGGATGCCACCTCCACTCTTCCGACACTGGCATCACCGACATTGCTTTGCACTCCTCCGGGATCAAGTCAGAAAAAGGAATATACACCAGACATATCTGGACTTTGTGCAATGTCGCGCTGCTTTCCATTTCCACCACCAGGATATACAAACAAGGGATATGA

Predicted protein sequences of Glyma0022s00346

Limit To All Plant Sequences

>Glyma0022s00346.1   sequence type=predicted peptide   gene model=Glyma0022s00346   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGPTYSDMGCKLALEDKKRVAFRRRHRHEHVDATRHAKPCNCSSLASQQQKGHRTKEKLIQFLCSSCLLCVCCPLACVCCFIKLPCRICHQALRCAQKWACYGSKNNRTVVLKVGMSCQGCAGAVNRILGKMEGIFIPASYLYYQIQNENDLVIVAMYFNSNILTPTINYGCHLHSSDTGITDIALHSSGIKSEKGIYTRHIWTLCNVALLSISTTRIYKQGI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain