|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G52970.1 | AT | cytochrome P450, family 76, subfamily G, polypeptide 1 | JGI | N/A | IEA |
| GO:0044550 | GO-bp | secondary metabolite biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | JGI | N/A | IEA |
| GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
| GO:0004497 | GO-mf | monooxygenase activity | EnsemblGenomes | N/A | IEA |
| GO:0005506 | GO-mf | iron ion binding | EnsemblGenomes | N/A | IEA |
| GO:0005506 | GO-mf | iron ion binding | JGI | N/A | IEA |
| GO:0009055 | GO-mf | electron carrier activity | JGI | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | EnsemblGenomes | N/A | IEA |
| GO:0016705 | GO-mf | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | EnsemblGenomes | N/A | IEA |
| GO:0016705 | GO-mf | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | JGI | N/A | IEA |
| GO:0016709 | GO-mf | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen | EnsemblGenomes | N/A | IEA |
| GO:0020037 | GO-mf | heme binding | EnsemblGenomes | N/A | IEA |
| GO:0020037 | GO-mf | heme binding | JGI | N/A | IEA |
| GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
| PTHR24298 | Panther | FAMILY NOT NAMED | JGI | N/A | IEA |
| PTHR24298:SF44 | Panther | JGI | N/A | IEA | |
| PF00067 | PFAM | Cytochrome P450 | JGI | N/A | IEA |
| PWY-5203 | SoyCyc9 | soybean saponin I biosynthesis | Plant Metabolic Network | ISS | |
| GN7V-65009 | SoyCyc9-rxn | β-amyrin 24-hydroxylase | Plant Metabolic Network | ISS |
|
Glyma.20g247100 not represented in the dataset |
Glyma.20g247100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma20g39120 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.20g247100.1 sequence-type=CDS polypeptide=Glyma.20g247100.1.p locus=Glyma.20g247100 ID=Glyma.20g247100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCAGAACTTCTGCACAATCCAAAAGCGCTAAAGAAAGTGCAAATGGAAATAAGGAGTAAAATAGGGCCAGATAGGAATATGGACGAAAAGGACATAGAAAACCTTTCCTACCTCCAAGCAGTCATCAAGGAGACACTGAGACTTCACCCGCCTCTTCCTCATATGGCCATGTACTCTTGCAACATGCTTGGCTACAATATTCCCCAAGGGTCCTTCATTTCCTTTGGTTCGGGTCGAAGAATGTGCCCAGCAATGCCACTTGCCTCTCGTGTGCTTCCCCCGCCAATAGGCTCACTCTTGTGCTCCTTTGATTGGGTCTTGCCAGATGGCGAAAACCAGAGGAGATGGACACCACAGAGGAAATGGGAATAA
>Glyma.20g247100.1.p sequence-type=predicted peptide transcript=Glyma.20g247100.1 locus=Glyma.20g247100 ID=Glyma.20g247100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAELLHNPKALKKVQMEIRSKIGPDRNMDEKDIENLSYLQAVIKETLRLHPPLPHMAMYSCNMLGYNIPQGSFISFGSGRRMCPAMPLASRVLPPPIGSLLCSFDWVLPDGENQRRWTPQRKWE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||