SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.20g191200

Feature Type:gene_model
Chromosome:Gm20
Start:42993081
stop:42994294
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.20g191200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G10520.1AT haemoglobin 2 JGI N/AIEA
GO:0006810GO-bp transport EnsemblGenomesN/AIEA
GO:0009399GO-bp nitrogen fixation EnsemblGenomesN/AIEA
GO:0009877GO-bp nodulation EnsemblGenomesN/AIEA
GO:0015671GO-bp oxygen transport EnsemblGenomesN/AIEA
GO:0005344GO-mf oxygen carrier activity EnsemblGenomesN/AIEA
GO:0005506GO-mf iron ion binding JGI N/AIEA
GO:0019825GO-mf oxygen binding EnsemblGenomesN/AIEA
GO:0020037GO-mf heme binding EnsemblGenomesN/AIEA
GO:0020037GO-mf heme binding JGI N/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
PTHR22924Panther LEGHEMOGLOBIN-RELATED JGI N/AIEA
PTHR22924:SF4Panther JGI N/AIEA
PF00042PFAM Globin JGI N/AIEA

Proteins Associated with Glyma.20g191200
LocusGene SymbolProtein Name
LBC2 leghemoglobin C2
LBC2 leghemoglobin C2

Expression Patterns of Glyma.20g191200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.20g191200
ParalogEvidenceComments
Glyma.10g198800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.20g191200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma20g33290 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.20g191200
>Glyma.20g191200.1 sequence-type=CDS polypeptide=Glyma.20g191200.1.p locus=Glyma.20g191200 ID=Glyma.20g191200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGTGCTTTCACTGAGAAGCAAGAGGCTTTGGTGAGTAGCTCATTCGAAGCATTCAAGGCAAACATTCCTCAATACAGCGTTGTGTTCTACACTTCGATACTGGAGAAAGCACCCGCAGCAAAGGACTTGTTCTCGTTTCTATCTAATGGAGTAGATCCTAGTAATCCTAAGCTCACGGGCCATGCTGAAAAGCTTTTTGGATTGGTGCGTGACTCAGCTGGTCAACTTAAAGCAAATGGAACAGTAGTGGCTGATGCCGCACTTGGTTCTATCCATGCCCAAAAAGCAATCACTGATCCTCAGTTCGTGGTGGTTAAAGAAGCACTGCTGAAAACAATAAAGGAGGCAGTTGGGGACAAATGGAGTGATGAATTGAGCAGTGCTTGGGAAGTAGCCTATGATGAATTGGCAGCAGCTATTAAGAAGGCATTTTAG
Predicted protein sequences of Glyma.20g191200
>Glyma.20g191200.1.p sequence-type=predicted peptide transcript=Glyma.20g191200.1 locus=Glyma.20g191200 ID=Glyma.20g191200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo