Glyma.20g151000

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.20g151000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.20g151000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.20g151000

Feature Type:	gene_model
Chromosome:	Gm20
Start:	38974348
stop:	38976077
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.20g151000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G22880.1	AT	DNA repair (Rad51) family protein	JGI	N/A	IEA
GO:0000730	GO-bp	DNA recombinase assembly	EnsemblGenomes	N/A	IEA
GO:0006259	GO-bp	DNA metabolic process	EnsemblGenomes	N/A	IEA
GO:0006312	GO-bp	mitotic recombination	EnsemblGenomes	N/A	IEA
GO:0007131	GO-bp	reciprocal meiotic recombination	EnsemblGenomes	N/A	IEA
GO:0010212	GO-bp	response to ionizing radiation	EnsemblGenomes	N/A	IEA
GO:0042148	GO-bp	strand invasion	EnsemblGenomes	N/A	IEA
GO:0070192	GO-bp	chromosome organization involved in meiotic cell cycle	EnsemblGenomes	N/A	IEA
GO:0000794	GO-cc	condensed nuclear chromosome	EnsemblGenomes	N/A	IEA
GO:0005654	GO-cc	nucleoplasm	EnsemblGenomes	N/A	IEA
GO:0000150	GO-mf	recombinase activity	EnsemblGenomes	N/A	IEA
GO:0000166	GO-mf	nucleotide binding	EnsemblGenomes	N/A	IEA
GO:0000400	GO-mf	four-way junction DNA binding	EnsemblGenomes	N/A	IEA
GO:0003677	GO-mf	DNA binding	EnsemblGenomes	N/A	IEA
GO:0003690	GO-mf	double-stranded DNA binding	EnsemblGenomes	N/A	IEA
GO:0003697	GO-mf	single-stranded DNA binding	EnsemblGenomes	N/A	IEA
GO:0004520	GO-mf	endodeoxyribonuclease activity	EnsemblGenomes	N/A	IEA
GO:0005524	GO-mf	ATP binding	EnsemblGenomes	N/A	IEA
GO:0008094	GO-mf	DNA-dependent ATPase activity	EnsemblGenomes	N/A	IEA
PTHR22942	Panther	RECA/RAD51/RADA DNA STRAND-PAIRING FAMILY MEMBER	JGI	N/A	IEA
PTHR22942:SF13	Panther		JGI	N/A	IEA
PF08423	PFAM	Rad51	JGI	N/A	IEA

Expression Patterns of Glyma.20g151000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.20g151000 not represented in the dataset	Glyma.20g151000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.20g151000

Paralog	Evidence	Comments
Glyma.10g243200	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.20g151000 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma20g28941	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.20g151000

Limit To All Plant Sequences

>Glyma.20g151000.1 sequence-type=CDS polypeptide=Glyma.20g151000.1.p locus=Glyma.20g151000 ID=Glyma.20g151000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAGCTTCAGGACGCAGGGATATATACTTGCAATGGCTTGATGATGCACACGAAGAAGAATTTGACTGGAATCAAAGGTCTATCTGAGGTTAAGGTCGATAAGATCTGCGAGGCTGCAGAGAAGATTGTGAATTTCGGTTATATTACCGGAAGTGACGCACTGCTCAAAGTACGTTGTTTATTGTTCATATCTGATCCAGGAGGTGGCGTGTTCGTAACTGATCCAAAGAAACCAGCAGGAGGGCATGTGCTAGTCCATGCAGCCACGGTAAGGTTGATGTTCAGGAAAGGGAAAGGGGAACAGCGCATTTGCAGAGTGTTTGACGCCCCCAACCTGCCAGAGGCTGAAGCAATATCCTTTTACCTGATTAACTCAATGTTAGTGAGTTACGTGTTCCAGATAACAGCAGGGGGGATTGCAGACGCTAAGGACTAA

Predicted protein sequences of Glyma.20g151000

Limit To All Plant Sequences

>Glyma.20g151000.1.p sequence-type=predicted peptide transcript=Glyma.20g151000.1 locus=Glyma.20g151000 ID=Glyma.20g151000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKLQDAGIYTCNGLMMHTKKNLTGIKGLSEVKVDKICEAAEKIVNFGYITGSDALLKVRCLLFISDPGGGVFVTDPKKPAGGHVLVHAATVRLMFRKGKGEQRICRVFDAPNLPEAEAISFYLINSMLVSYVFQITAGGIADAKD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain