|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G43400.1 | AT | electron-transfer flavoprotein:ubiquinone oxidoreductase | JGI | N/A | IEA |
| GO:0022904 | GO-bp | respiratory electron transport chain | EnsemblGenomes | N/A | IEA |
| GO:0017133 | GO-cc | mitochondrial electron transfer flavoprotein complex | EnsemblGenomes | N/A | IEA |
| GO:0031305 | GO-cc | integral component of mitochondrial inner membrane | EnsemblGenomes | N/A | IEA |
| GO:0004174 | GO-mf | electron-transferring-flavoprotein dehydrogenase activity | EnsemblGenomes | N/A | IEA |
| GO:0009055 | GO-mf | electron transfer activity | EnsemblGenomes | N/A | IEA |
| GO:0043783 | GO-mf | oxidoreductase activity, oxidizing metal ions with flavin as acceptor | EnsemblGenomes | N/A | IEA |
| GO:0048039 | GO-mf | ubiquinone binding | EnsemblGenomes | N/A | IEA |
| GO:0051539 | GO-mf | 4 iron, 4 sulfur cluster binding | EnsemblGenomes | N/A | IEA |
| GN7V-65935 | SoyCyc9-rxn | electron-transferring-flavoprotein dehydrogenase
| Plant Metabolic Network | ISS |
|
Glyma.20g093500 not represented in the dataset |
Glyma.20g093500 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma20g22587 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.20g093500.1 sequence-type=CDS polypeptide=Glyma.20g093500.1.p locus=Glyma.20g093500 ID=Glyma.20g093500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCAATAATAAGAATGCTAGCTTCAGCTTTGTCATGGGTGACAGTTGCTTATAGAAATTTCAGGATTCAAGCCATTCAGTTTTTCTTGGGTGACATTCAACAAACAAAAATACATCTTTTTTTTTCTCTCTCTCACACACACACCTTCCCCATTGCTAATAATTCTTACCATTCATTTTCTGGCCGCCATGCTTTCTCATCTTCTCAGCCACATGCCAATTCTAGGGTTTCAACTTCTCGGAGCTTTTGCACCACATCCTTCGACAGGGACTCCATCGAGTACGACGTCGTCATCGTCGATACCGGTCCCACCGGCTTATCGGCGACGATACAACTCAAGCAAATGTGCTGCCAAAGAAACCTCGATTTGTTCGTCTGTGTCCTCGAGAAAAGGCATGATCTGGCTACCCTCTCATGTTTTGGACGAGGCATATGA
>Glyma.20g093500.1.p sequence-type=predicted peptide transcript=Glyma.20g093500.1 locus=Glyma.20g093500 ID=Glyma.20g093500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAIIRMLASALSWVTVAYRNFRIQAIQFFLGDIQQTKIHLFFSLSHTHTFPIANNSYHSFSGRHAFSSSQPHANSRVSTSRSFCTTSFDRDSIEYDVVIVDTGPTGLSATIQLKQMCCQRNLDLFVCVLEKRHDLATLSCFGRGI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||