Glyma.20g085800

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.20g085800

Feature Type:	gene_model
Chromosome:	Gm20
Start:	31986249
stop:	31990029
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.20g085800

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G35620.1	AT	Eukaryotic initiation factor 4E protein	JGI	N/A	IEA
GO:0006412	GO-bp	translation	EnsemblGenomes	N/A	IEA
GO:0006413	GO-bp	translational initiation	EnsemblGenomes	N/A	IEA
GO:0006413	GO-bp	translational initiation	JGI	N/A	IEA
GO:0005737	GO-cc	cytoplasm	EnsemblGenomes	N/A	IEA
GO:0005737	GO-cc	cytoplasm	JGI	N/A	IEA
GO:0003723	GO-mf	RNA binding	EnsemblGenomes	N/A	IEA
GO:0003723	GO-mf	RNA binding	JGI	N/A	IEA
GO:0003743	GO-mf	translation initiation factor activity	EnsemblGenomes	N/A	IEA
GO:0003743	GO-mf	translation initiation factor activity	JGI	N/A	IEA
KOG1670	KOG	Translation initiation factor 4F, cap-binding subunit (eIF-4E) and related cap-binding proteins	JGI	N/A	IEA
PTHR11960	Panther	EUKARYOTIC TRANSLATION INITIATION FACTOR 4E RELATED	JGI	N/A	IEA
PF01652	PFAM	Eukaryotic initiation factor 4E	JGI	N/A	IEA

Expression Patterns of Glyma.20g085800

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.20g085800 not represented in the dataset	Glyma.20g085800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.20g085800

Paralog	Evidence	Comments
Glyma.10g136100	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.20g085800 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma20g21493	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.20g085800

Limit To All Plant Sequences

>Glyma.20g085800.1 sequence-type=CDS polypeptide=Glyma.20g085800.1.p locus=Glyma.20g085800 ID=Glyma.20g085800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCAACAAGCGAAGAAGTGGTTGCGGCGGCGCCGGAGGCAGCCGCGCTGGAGGCAGGGCTGAAGCACAAACTGGAGAGAAAATGGACGTTTTGGTGCGACAACCAATCCAAACCCAAACAGGGCGCTGCTTGGGGTACCTCTCTTCGCAAGGTCTACACCTTCGACACCGTTGAAGAGTTCTGGTGTTTGTATGATCAGGTATTCAAGCCCAGCAAGTTGCAAATCAATGCGGATTTTCACTTGTTCAAGACTGGGATTGAGCCTAAATGGGAAGATCCTGAGTGTGCCAATGGAGGAAAGTGGTCAGTCACCAGCAACAGCGGCAGGAAGGCTAACCTTGATAACATGTGGCTTGAAACTATGATGGCTTTGATTGGGGAGCAATTTGAGGATGCCGAGGACATATGTGGTGTTGTTGCGAGTGTGCGCCAGTGGCAGGACAAACTTTCGTTGTGGACAAAGACAGCGGCAAATGAGGCTGCCCAGATGAGCATTGGAAGGAAGTGGAAGGAAATCATAGATGTTAACGACAAGATAACATACAACTTTCATGATGATTCTAGAACCAAAGGAGCATCAAAGGGTCGATACACCGTATAA

Predicted protein sequences of Glyma.20g085800

Limit To All Plant Sequences

>Glyma.20g085800.1.p sequence-type=predicted peptide transcript=Glyma.20g085800.1 locus=Glyma.20g085800 ID=Glyma.20g085800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MATSEEVVAAAPEAAALEAGLKHKLERKWTFWCDNQSKPKQGAAWGTSLRKVYTFDTVEEFWCLYDQVFKPSKLQINADFHLFKTGIEPKWEDPECANGGKWSVTSNSGRKANLDNMWLETMMALIGEQFEDAEDICGVVASVRQWQDKLSLWTKTAANEAAQMSIGRKWKEIIDVNDKITYNFHDDSRTKGASKGRYTV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain