SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.20g072300

Feature Type:gene_model
Chromosome:Gm20
Start:25602439
stop:25603655
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.20g072300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G28950.1AT RHO-related protein from plants 9 JGI N/AIEA
GO:0007264GO-bp small GTPase mediated signal transduction JGI N/AIEA
GO:0003924GO-mf GTPase activity EnsemblGenomesN/AIEA
GO:0005525GO-mf GTP binding EnsemblGenomesN/AIEA
GO:0005525GO-mf GTP binding JGI N/AIEA
PTHR24072Panther RHO FAMILY GTPASE JGI N/AIEA
PTHR24072:SF352Panther JGI N/AIEA
PF00071PFAM Ras family JGI N/AIEA

Expression Patterns of Glyma.20g072300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.20g072300 not represented in the dataset
Glyma.20g072300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.20g072300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma20g17426 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.20g072300
>Glyma.20g072300.1 sequence-type=CDS polypeptide=Glyma.20g072300.1.p locus=Glyma.20g072300 ID=Glyma.20g072300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCCTGTGAACTGCGATTTCTCCAAATTTCCCAAAGGTCTTGCCTGCCAATTAACCCAATTCCAACAAGGGATGCCGGAATTGCGTAGATTTGCACCTAATGTTCCAATTGTTCTTGTTGGTACGAAGTTAGACCGGGGTTATGTAGCTGATCACATGGGATCTAATGTCATAACATCTGCTGAGGGGGAAGAAATGAGGAAACAAATTGGTGCAGCTGCTTACATTGAGTGCAGTTCAAAGAATCAACAGAATGTCAAAGCAGTGTTTGACACTGCAATTAAGGTTGTTCTGGAACCTCCAAGGAGGAAACAAATGGCATGGAAGAAAAGTCATAGAAGGTCTGGTTGCTCATTTGTGTAA
Predicted protein sequences of Glyma.20g072300
>Glyma.20g072300.1.p sequence-type=predicted peptide transcript=Glyma.20g072300.1 locus=Glyma.20g072300 ID=Glyma.20g072300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MPVNCDFSKFPKGLACQLTQFQQGMPELRRFAPNVPIVLVGTKLDRGYVADHMGSNVITSAEGEEMRKQIGAAAYIECSSKNQQNVKAVFDTAIKVVLEPPRRKQMAWKKSHRRSGCSFV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo