|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G28780.1 | AT | PIF1 helicase | JGI | N/A | IEA |
| GO:0000723 | GO-bp | telomere maintenance | EnsemblGenomes | N/A | IEA |
| GO:0000723 | GO-bp | telomere maintenance | JGI | N/A | IEA |
| GO:0006281 | GO-bp | DNA repair | EnsemblGenomes | N/A | IEA |
| GO:0006281 | GO-bp | DNA repair | JGI | N/A | IEA |
| GO:0006310 | GO-bp | DNA recombination | EnsemblGenomes | N/A | IEA |
| GO:0006974 | GO-bp | cellular response to DNA damage stimulus | EnsemblGenomes | N/A | IEA |
| GO:0032508 | GO-bp | DNA duplex unwinding | EnsemblGenomes | N/A | IEA |
| GO:0000166 | GO-mf | nucleotide binding | EnsemblGenomes | N/A | IEA |
| GO:0003678 | GO-mf | DNA helicase activity | EnsemblGenomes | N/A | IEA |
| GO:0003678 | GO-mf | DNA helicase activity | JGI | N/A | IEA |
| GO:0004386 | GO-mf | helicase activity | EnsemblGenomes | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
| GO:0016787 | GO-mf | hydrolase activity | EnsemblGenomes | N/A | IEA |
| PTHR10492 | Panther | UNCHARACTERIZED | JGI | N/A | IEA |
| PF05970 | PFAM | PIF1-like helicase | JGI | N/A | IEA |
|
Glyma.20g070900 not represented in the dataset |
Glyma.20g070900 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma20g17066 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.20g070900.1 sequence-type=CDS polypeptide=Glyma.20g070900.1.p locus=Glyma.20g070900 ID=Glyma.20g070900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGTTGCAAATAATGATGGTAACATTAGGGCAACAAATCAAGATTATCGGTTGCTTATGACAAGTGATCATAAAGAGTATCTTAGCTCTAACTCAATTGACATGTCTAATACGATTGATAACATTCCATTAGAGGCAATTACTCTGGAATTTCTGAATATATTAAAGACATATGGTATTCCTAATCATAACATCAAATTAAAGACATGTAATCCAATTATGTTGCTCAGAAATCTGGATCAATATGAAGATCTATGCAATGGAACAAGATTAACAGTAACAAGACTTGTAGATCATGTCATTGAAGCAAAAATCATTTCTAGAAAAAATGTAGGAAATCTAATTTACATTCCAAGAATGTCTTTGTCTCTATCGCAATCACCTCGGCCTTTCAAACTTATCAAAAGACAAATTCCTTTAATTGTCTCATATGCTATGACTATTAACAAGTCTTAA
>Glyma.20g070900.1.p sequence-type=predicted peptide transcript=Glyma.20g070900.1 locus=Glyma.20g070900 ID=Glyma.20g070900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MVANNDGNIRATNQDYRLLMTSDHKEYLSSNSIDMSNTIDNIPLEAITLEFLNILKTYGIPNHNIKLKTCNPIMLLRNLDQYEDLCNGTRLTVTRLVDHVIEAKIISRKNVGNLIYIPRMSLSLSQSPRPFKLIKRQIPLIVSYAMTINKS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||