|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G27740.2 | AT | carbamoyl phosphate synthetase A | JGI | N/A | IEA |
GO:0009220 | GO-bp | pyrimidine ribonucleotide biosynthetic process | EnsemblGenomes | N/A | IEA |
GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
GO:0004070 | GO-mf | aspartate carbamoyltransferase activity | EnsemblGenomes | N/A | IEA |
PTHR11405 | Panther | CARBAMOYLTRANSFERASE RELATED | JGI | N/A | IEA |
PF00988 | PFAM | Carbamoyl-phosphate synthase small chain, CPSase domain | JGI | N/A | IEA |
ARGSYN-PWY | SoyCyc9 | L-arginine biosynthesis I (via L-ornithine) | Plant Metabolic Network | ISS | |
ARGSYNBSUB-PWY | SoyCyc9 | L-arginine biosynthesis II (acetyl cycle) | Plant Metabolic Network | ISS | |
GLUTAMINDEG-PWY | SoyCyc9 | L-glutamine degradation I | Plant Metabolic Network | ISS | |
PWY-4984 | SoyCyc9 | urea cycle | Plant Metabolic Network | ISS | |
PWY-5686 | SoyCyc9 | UMP biosynthesis I | Plant Metabolic Network | ISS | |
PWY-7060 | SoyCyc9 | ornithine-citrulline shuttle | Plant Metabolic Network | ISS | |
PWY-7211 | SoyCyc9 | superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
PWY0-162 | SoyCyc9 | superpathway of pyrimidine ribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
GN7V-65751 | SoyCyc9-rxn | Enzyme name not determined | Plant Metabolic Network | ISS |
Glyma.20g057200 not represented in the dataset |
Glyma.20g057200 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma20g13798 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.20g057200.1 sequence-type=CDS polypeptide=Glyma.20g057200.1.p locus=Glyma.20g057200 ID=Glyma.20g057200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGTGGAAGCTGCCGACCCTACCTGGAACAAAGAAAAGGAAAGTAGAAGAAAGGGTGAGTGGTTCTTCAGACATATCTGTAACGTTGTTTCTGTGAGAGCATCAATGGCGACAAAAGCTTTGTCCTTCGCTCTGTCTCTCAATGACCTCACCAACAAGCACTTCTCTTCCAATACGCCACACACCGCCACTAAAGTTTCCGTCTTTACTGTCCAATGCTCTTCTTCGGGTGGTGGAGAGAGGCCTTGGAAGAATTCAAATGCTAGACTTGTGCTTGAAGATGGTTCAATTTGGAAAGCAAAATCATTTGGTGCTTCGGGGACTCAAGTTGGCGAAGTTTTTTTTAATACATCATTGATAGGATGA
>Glyma.20g057200.1.p sequence-type=predicted peptide transcript=Glyma.20g057200.1 locus=Glyma.20g057200 ID=Glyma.20g057200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MVEAADPTWNKEKESRRKGEWFFRHICNVVSVRASMATKALSFALSLNDLTNKHFSSNTPHTATKVSVFTVQCSSSGGGERPWKNSNARLVLEDGSIWKAKSFGASGTQVGEVFFNTSLIG*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||