SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.20g017900

Feature Type:gene_model
Chromosome:Gm20
Start:1834429
stop:1835678
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G14940.1AT Polyketide cyclase/dehydrase and lipid transport superfamily protein JGI N/AIEA
GO:0006952GO-bp defense response EnsemblGenomesN/AIEA
GO:0006952GO-bp defense response JGI N/AIEA
GO:0009607GO-bp response to biotic stimulus EnsemblGenomesN/AIEA
GO:0009607GO-bp response to biotic stimulus JGI N/AIEA
PF00407PFAM Pathogenesis-related protein Bet v I family JGI N/AIEA

LocusGene SymbolProtein Name
MSG MLP-like protein 28-like

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.07g219700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma20g02210 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.20g017900.1 sequence-type=CDS polypeptide=Glyma.20g017900.1.p locus=Glyma.20g017900 ID=Glyma.20g017900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTCTCAACCCGACTCGTTGGTGGCTGAGATTGAGGTGAAAACCTCTGCTGATCACTTTTACGACACCTTGAAGGGTAAGAAACAGCATCGTATTCATGATGTTGCCCCTCATCATATCCATAAGGTGGAAGTTCATGAAGGTGAGTGGGATAAATCTGGCAATATCAAGGTGCTTACATTCGCTGATGGGGACACTGTTGAGACCTTAAAGGAGAGAGTTGATTTTGATGATGAAAACAAGAAGATAACCTACACCATATTGGAGGGTGTCATGTTGAAGTACTATAAGAGCTACAAGGTTATCGTTCATGTTTTACCAAAAGGTGATGAGCACAGCCTTGTGAAGTGGACTTTCTTGTATGAGAAGGTGGATCACACTGCCCCTGAGCCAACCAAGTACAAAGATTTGGTGGTTAAACTCACCAAGAACGTGGAGGCTCATCTTGTTGAGGCTCGTTAA

>Glyma.20g017900.1.p sequence-type=predicted peptide transcript=Glyma.20g017900.1 locus=Glyma.20g017900 ID=Glyma.20g017900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSQPDSLVAEIEVKTSADHFYDTLKGKKQHRIHDVAPHHIHKVEVHEGEWDKSGNIKVLTFADGDTVETLKERVDFDDENKKITYTILEGVMLKYYKSYKVIVHVLPKGDEHSLVKWTFLYEKVDHTAPEPTKYKDLVVKLTKNVEAHLVEAR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo