SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.19g243000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.19g243000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.19g243000

Feature Type:gene_model
Chromosome:Gm19
Start:49064912
stop:49066631
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.19g243000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G04880.1AT DNA-damage-repair/toleration protein (DRT102) JGI N/AIEA
GO:0005975GO-bp carbohydrate metabolic process EnsemblGenomesN/AIEA
GO:0005975GO-bp carbohydrate metabolic process JGI N/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0009409GO-bp response to cold EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0005829GO-cc cytosol EnsemblGenomesN/AIEA
GO:0016853GO-mf isomerase activity EnsemblGenomesN/AIEA
GO:0016853GO-mf isomerase activity JGI N/AIEA
PF02502PFAM Ribose/Galactose Isomerase JGI N/AIEA
PF07883PFAM Cupin domain JGI N/AIEA
CALVIN-PWYSoyCyc9 Calvin-Benson-Bassham cycle Plant Metabolic Network ISS
NONOXIPENT-PWYSoyCyc9 pentose phosphate pathway (non-oxidative branch) Plant Metabolic Network ISS
PENTOSE-P-PWYSoyCyc9 pentose phosphate pathway Plant Metabolic Network ISS
PHOTOALL-PWYSoyCyc9 oxygenic photosynthesis Plant Metabolic Network ISS
PWY-5723SoyCyc9 Rubisco shunt Plant Metabolic Network ISS
GN7V-65586SoyCyc9-rxn ribose-5-phosphate isomerase Plant Metabolic Network ISS

Expression Patterns of Glyma.19g243000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.19g243000 not represented in the dataset
Glyma.19g243000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.19g243000 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma19g43230 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.19g243000
>Glyma.19g243000.1 sequence-type=CDS polypeptide=Glyma.19g243000.1.p locus=Glyma.19g243000 ID=Glyma.19g243000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCAGCAGAACCCACCCGCCCCGTAAAAATCATCGCCGCCGCCGATGACTTCGGCACTCCTCTCAAAGACGCCCTCGTCGCTCACTTGCGCACTCTCAACATCCAAGTCGAAGATCTCGGAACCTCTTCCTACTACTCCGCCGGAGCCGAGGTCGGTCGCCGAGTCTCCCAATCCTCCTCCTCCGACATCCGTGGCCTCGTCGCCTGCGGCACCGGCGCCGGCGTCTCCATCTTCGCCAACAAATATCCCGGCGTCTACGCCGCCACGTGCCTCTCCCCCTCCGACGCCGTCAACGCCCGCTCCATCAACAACTCCAACGTCCTCGCCGTCTCCGGCAAGTACACGTCGCCAGAGGCCGCAGTCGAGGTCCTGGACGCGTGGCTGAACACGCCGTTCAAGTCCGCGTGCCCGGCCAACGACGACAAGCCCTGGCCGCAGGAGATTCACTCCTTTCTCGAACACTCGCTCGTGGAGATGCCGGAGATCGGAAAAGAGGGCGCGTTTGACACGTGCGCGGTGTGCTGTCTGGTGAAGAACCGGGAACTGAATCCGATCGATTTGATTCCGGGCGGGTCGATGAAGATTCTAAGGGAAACTCCGACGTCGGCGTTCGTGAGGTTCAAGGCCGGGAGCGTGGAGCCCGCACACCACCACACGTTTGGGCACGACTTGGTTGTGATCGAAGGGAAGAAGAGCGTTTGGAATCTGACGAAGGAACAGAGGTATGATCTGACGGTTGGGGATTATTTATTCACTCCCCCAGGGGATGTGCATAGGGTTAAGTATCATGAGGATACTGAATTTTTCATCAAGTGGGATGGCCATTGGGATATGTTCTTTGACGAGGATCTCGACACTGCTAAAAACGCTATTGATAAGGAGTTAGGATTAGCCAAGTGA
Predicted protein sequences of Glyma.19g243000
>Glyma.19g243000.1.p sequence-type=predicted peptide transcript=Glyma.19g243000.1 locus=Glyma.19g243000 ID=Glyma.19g243000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAAEPTRPVKIIAAADDFGTPLKDALVAHLRTLNIQVEDLGTSSYYSAGAEVGRRVSQSSSSDIRGLVACGTGAGVSIFANKYPGVYAATCLSPSDAVNARSINNSNVLAVSGKYTSPEAAVEVLDAWLNTPFKSACPANDDKPWPQEIHSFLEHSLVEMPEIGKEGAFDTCAVCCLVKNRELNPIDLIPGGSMKILRETPTSAFVRFKAGSVEPAHHHTFGHDLVVIEGKKSVWNLTKEQRYDLTVGDYLFTPPGDVHRVKYHEDTEFFIKWDGHWDMFFDEDLDTAKNAIDKELGLAK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo