|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G62950.1 | AT | Thioredoxin superfamily protein | JGI | N/A | IEA |
GO:0022900 | GO-bp | electron transport chain | EnsemblGenomes | N/A | IEA |
GO:0045454 | GO-bp | cell redox homeostasis | EnsemblGenomes | N/A | IEA |
GO:0045454 | GO-bp | cell redox homeostasis | JGI | N/A | IEA |
GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
GO:0005623 | GO-cc | cell | EnsemblGenomes | N/A | IEA |
GO:0009055 | GO-mf | electron transfer activity | EnsemblGenomes | N/A | IEA |
GO:0009055 | GO-mf | electron carrier activity | JGI | N/A | IEA |
GO:0015035 | GO-mf | protein disulfide oxidoreductase activity | EnsemblGenomes | N/A | IEA |
GO:0015035 | GO-mf | protein disulfide oxidoreductase activity | JGI | N/A | IEA |
KOG1752 | KOG | Glutaredoxin and related proteins | JGI | N/A | IEA |
PTHR10168 | Panther | GLUTAREDOXIN | JGI | N/A | IEA |
PF00462 | PFAM | Glutaredoxin | JGI | N/A | IEA |
THIOREDOX-PWY | SoyCyc9 | thioredoxin pathway | Plant Metabolic Network | ISS | |
GN7V-66975 | SoyCyc9-rxn | thioredoxin-disulfide reductase | Plant Metabolic Network | ISS |
Glyma.19g207400 not represented in the dataset |
Glyma.19g207400 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.03g210200 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma19g39490 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.19g207400.1 sequence-type=CDS polypeptide=Glyma.19g207400.1.p locus=Glyma.19g207400 ID=Glyma.19g207400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGATAGAGTTAAGGACTTGGCATCAAAGAAGGCTGCTGTTATATTTACCAAGAGTTCATGTTGCATGTGTCACAGCATAAAGCAACTTTTCTATGAGCTTGGAGCAAGCCCAGCAGTTCATGAGCTTGACAATGATTCCTATGGGAAGGAAATGGAGTGGGCTTTGAGGGGTATGGGTTGTAACCCTTCAGTCCCAGCAGTGTTCATAGGTGGAAAATTTGTGGGCTCATCCAAAGATGTTATATCCCTCCATGTTGATGGCTCCCTCAAACAATTGCTCATGGATGCAAAAGCCATCTGGTTTTAG
>Glyma.19g207400.1.p sequence-type=predicted peptide transcript=Glyma.19g207400.1 locus=Glyma.19g207400 ID=Glyma.19g207400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MDRVKDLASKKAAVIFTKSSCCMCHSIKQLFYELGASPAVHELDNDSYGKEMEWALRGMGCNPSVPAVFIGGKFVGSSKDVISLHVDGSLKQLLMDAKAIWF*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||