Report for Sequence Feature Glyma.19g192400
Feature Type: gene_model
Chromosome: Gm19
Start: 44974572
stop: 44975820
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.19g192400
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G36450.1 AT
Integrase-type DNA-binding superfamily protein
JGI N/A IEA
GO:0006351 GO-bp
transcription, DNA-templated
EnsemblGenomes N/A IEA
GO:0006355 GO-bp
regulation of transcription, DNA-templated
EnsemblGenomes N/A IEA
GO:0006355 GO-bp
regulation of transcription, DNA-templated
JGI N/A IEA
GO:0005634 GO-cc
nucleus
EnsemblGenomes N/A IEA
GO:0003677 GO-mf
DNA binding
EnsemblGenomes N/A IEA
GO:0003700 GO-mf
DNA binding transcription factor activity
EnsemblGenomes N/A IEA
GO:0003700 GO-mf
sequence-specific DNA binding transcription factor activity
JGI N/A IEA
PF00847 PFAM
AP2 domain
JGI N/A IEA
Expression Patterns of Glyma.19g192400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.19g192400
Paralog Evidence Comments
Glyma.03g191800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.19g192400 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma19g37670 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.19g192400
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.19g192400.1 sequence-type=CDS polypeptide=Glyma.19g192400.1.p locus=Glyma.19g192400 ID=Glyma.19g192400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCGTTCCAGCAACGGTACATCAAGCAGCAGGGCCTCCAACGGTAACACAGGGCGCCACCCTGTTTACCGTGGAGTGAGGCGTAGGAGTAGTGGTAAATGGGTTTCTGAAATCCGTGAGCCCAAAAAACCTAACAGGATTTGGTTAGGGACATTTGCCACCCCTGAAATGGCTGCTATTGCCTATGACGTGGCAGCGCTTGCTCTTAAGGGTAAGGATGCTGAGCTCAACTTCCCTAACTCGGCTTCCTCCCTCCCTATCCCTGCATCATCTGCAGCTCACGACATTCAGATGGCTGCAGCACTAGCTGCAACCGCTGTCGGAGCAGCGAATGATGCACTGGAAGGAAGCCAAGGAGGAAATGTTTCGGTTTCATTGGCGGAAGAGTTTTCAGGGGGAAACTTAAATCACTTTGTGGATGAGGACTTGATCTTTGACATGCCGAATATTCTGGTCAATATGGCTGAAGGAATGCTACTCAGCCCTCCTCGTTTTGATAATTTTGCTGCTACCGACTATGAATACATGGATGAAGATCCTAACCTCTGGGGGTTCCCTAATTACTAG
Predicted protein sequences of Glyma.19g192400
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.19g192400.1.p sequence-type=predicted peptide transcript=Glyma.19g192400.1 locus=Glyma.19g192400 ID=Glyma.19g192400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MRSSNGTSSSRASNGNTGRHPVYRGVRRRSSGKWVSEIREPKKPNRIWLGTFATPEMAAIAYDVAALALKGKDAELNFPNSASSLPIPASSAAHDIQMAAALAATAVGAANDALEGSQGGNVSVSLAEEFSGGNLNHFVDEDLIFDMPNILVNMAEGMLLSPPRFDNFAATDYEYMDEDPNLWGFPNY*