|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G03455.1 | AT | Rhodanese/Cell cycle control phosphatase superfamily protein | JGI | N/A | IEA |
| GO:0006468 | GO-bp | protein phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0035335 | GO-bp | peptidyl-tyrosine dephosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0046685 | GO-bp | response to arsenic-containing substance | EnsemblGenomes | N/A | IEA |
| GO:0005739 | GO-cc | mitochondrion | EnsemblGenomes | N/A | IEA |
| GO:0009507 | GO-cc | chloroplast | EnsemblGenomes | N/A | IEA |
| GO:0004725 | GO-mf | protein tyrosine phosphatase activity | EnsemblGenomes | N/A | IEA |
| KOG1530 | KOG | Rhodanese-related sulfurtransferase | JGI | N/A | IEA |
| PF00581 | PFAM | Rhodanese-like domain | JGI | N/A | IEA |
| GN7V-51330 | SoyCyc9-rxn | Enzyme name not determined | Plant Metabolic Network | ISS |
|
Glyma.19g185200 not represented in the dataset |
Glyma.19g185200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma19g36900 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.19g185200.1 sequence-type=CDS polypeptide=Glyma.19g185200.1.p locus=Glyma.19g185200 ID=Glyma.19g185200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTCGCAGTATATCGTACATAACGGGGTCGCAGCTTCTCTCTCTCAGACGCCATCCAAGCATCGCCGTCGTCGATGTAAGGGACGATGAGAGGAGCTACGACGGACACATATCGGGGTCTCTTCATTACGCAAGCGACACTTTCTCCGATAACATCTCAAATCTCATTCAGGCAGTTAAAGGCAAAGACACTCTCGTCTTCCACTGCGCTCTAAGTCAGGTTCGTGGCCCAACTTGTGCTAGGAGGCTTGTCAATTATCTTGAGGAGAACAAGGAAGATACTGGGATAAAGAACATTATGGTCTTGGAACGTGGCTTCAATGGGTGGGAAGCTTCTGGTAGACCCGTTTGCCGCTGCACCAATATTCCTTGCAAAGGAGAGTTGTCTCCTTAA
>Glyma.19g185200.1.p sequence-type=predicted peptide transcript=Glyma.19g185200.1 locus=Glyma.19g185200 ID=Glyma.19g185200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MARSISYITGSQLLSLRRHPSIAVVDVRDDERSYDGHISGSLHYASDTFSDNISNLIQAVKGKDTLVFHCALSQVRGPTCARRLVNYLEENKEDTGIKNIMVLERGFNGWEASGRPVCRCTNIPCKGELSP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||