|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G36880.1 | AT | methionine adenosyltransferase 3 | JGI | N/A | IEA |
| GO:0006556 | GO-bp | S-adenosylmethionine biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0006556 | GO-bp | S-adenosylmethionine biosynthetic process | JGI | N/A | IEA |
| GO:0005829 | GO-cc | cytosol | EnsemblGenomes | N/A | IEA |
| GO:0004478 | GO-mf | methionine adenosyltransferase activity | EnsemblGenomes | N/A | IEA |
| GO:0004478 | GO-mf | methionine adenosyltransferase activity | JGI | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
| PTHR11964 | Panther | S-ADENOSYLMETHIONINE SYNTHETASE | JGI | N/A | IEA |
| PF02773 | PFAM | S-adenosylmethionine synthetase, C-terminal domain | JGI | N/A | IEA |
| ETHYL-PWY | SoyCyc9 | ethylene biosynthesis I (plants) | Plant Metabolic Network | ISS | |
| METHIONINE-DEG1-PWY | SoyCyc9 | L-methionine degradation I (to L-homocysteine) | Plant Metabolic Network | ISS | |
| PWY-5041 | SoyCyc9 | S-adenosyl-L-methionine cycle II | Plant Metabolic Network | ISS | |
| PWY-5912 | SoyCyc9 | 2'-deoxymugineic acid phytosiderophore biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7270 | SoyCyc9 | L-methionine salvage cycle II (plants) | Plant Metabolic Network | ISS | |
| PWY-7528 | SoyCyc9 | L-methionine salvage cycle I (bacteria and plants) | Plant Metabolic Network | ISS | |
| SAM-PWY | SoyCyc9 | S-adenosyl-L-methionine biosynthesis | Plant Metabolic Network | ISS | |
| GN7V-54380 | SoyCyc9-rxn | methionine adenosyltransferase | Plant Metabolic Network | ISS |
|
Glyma.19g184700 not represented in the dataset |
Glyma.19g184700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma19g36840 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.19g184700.1 sequence-type=CDS polypeptide=Glyma.19g184700.1.p locus=Glyma.19g184700 ID=Glyma.19g184700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCAATTGGAGATTCCAGACAAGGACATCTTGGCTCTGATGAAGGAAAATTTTGACTTCAGGCCAGGAATGATTGCCATCAATCTTGATCTCATGAGAGGAGGCAACTTCAGGTTCCAGAAAACTGCTGCTTATGGACATTTTGGACGTGACGATCCTGATTTCACTTGGGAGACCATCAAGATCCTCAAGCCTAACGCTTGA
>Glyma.19g184700.1.p sequence-type=predicted peptide transcript=Glyma.19g184700.1 locus=Glyma.19g184700 ID=Glyma.19g184700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MQLEIPDKDILALMKENFDFRPGMIAINLDLMRGGNFRFQKTAAYGHFGRDDPDFTWETIKILKPNA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||