|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G37510.1 | AT | RNA-binding (RRM/RBD/RNP motifs) family protein | JGI | N/A | IEA |
GO:0003676 | GO-mf | nucleic acid binding | EnsemblGenomes | N/A | IEA |
GO:0003676 | GO-mf | nucleic acid binding | JGI | N/A | IEA |
GO:0003723 | GO-mf | RNA binding | EnsemblGenomes | N/A | IEA |
PTHR24012 | Panther | FAMILY NOT NAMED | JGI | N/A | IEA |
PTHR24012:SF187 | Panther | JGI | N/A | IEA | |
PF00076 | PFAM | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | JGI | N/A | IEA |
Glyma.19g173200 not represented in the dataset |
Glyma.19g173200 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.03g172300 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma19g35670 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.19g173200.1 sequence-type=CDS polypeptide=Glyma.19g173200.1.p locus=Glyma.19g173200 ID=Glyma.19g173200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTTTTATGTCTGGAGTTCAGCGTCTGCTTCGCCGCACTCCACTTGTTCATTCCCACTATGCTTCTATTCGTCTCAGCTCAACTCTCACTTCCCCCAAACTTTTCGTAAGCGGTCTTTGTAGACTGACAACAGATGAAAAACTTAAGGAAGCATTTTCGTCTTTTGGGCAGCTGGTTGAAGCTAAGGTGATAATTGATAGAGCCTCTGGAAGATCAAAGGGGTTTGCTTTTGTAACTTATACAACCATAGAGGAAGCTGAAAAGGCAAGAGAAGGAATGAACGCTAAATTTTTGGATGGATGGGTTATATTTGTTGATCCTGCCAAGCCAAGAGAGCCCAGACCTCCCCAGCAGTCACAGTCTCAACCCTCTGAAACAGGTTTCACTGTCAACAAAACGGTTGGGTGGTGTGGTTGA
>Glyma.19g173200.1.p sequence-type=predicted peptide transcript=Glyma.19g173200.1 locus=Glyma.19g173200 ID=Glyma.19g173200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAFMSGVQRLLRRTPLVHSHYASIRLSSTLTSPKLFVSGLCRLTTDEKLKEAFSSFGQLVEAKVIIDRASGRSKGFAFVTYTTIEEAEKAREGMNAKFLDGWVIFVDPAKPREPRPPQQSQSQPSETGFTVNKTVGWCG*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||