Report for Sequence Feature Glyma.19g151100
Feature Type: gene_model
Chromosome: Gm19
Start: 41141615
stop: 41142515
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.19g151100
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G42500.1 AT
Disease resistance-responsive (dirigent-like protein) family protein
JGI N/A IEA
GO:0005576 GO-cc
extracellular region
EnsemblGenomes N/A IEA
GO:0048046 GO-cc
apoplast
EnsemblGenomes N/A IEA
GO:0016853 GO-mf
isomerase activity
EnsemblGenomes N/A IEA
PTHR21495 Panther
NUCLEOPORIN-RELATED
JGI N/A IEA
PF03018 PFAM
Dirigent-like protein
JGI N/A IEA
Proteins Associated with Glyma.19g151100
Locus Gene Symbol Protein Name
PTS3 pterocarpan synthase
Expression Patterns of Glyma.19g151100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.19g151100
Paralog Evidence Comments
Glyma.03g147700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.19g151100 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma19g33310 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.19g151100
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.19g151100.1 sequence-type=CDS polypeptide=Glyma.19g151100.1.p locus=Glyma.19g151100 ID=Glyma.19g151100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCCAAATCCACTTTCTTCATCTGCCTTAACCTTTCATTACTCTTCTCTCTAGTCACGGCCACTTACTACTCAAGTTTAACCCCAACGCTTCTGGGTTTTCGCGAGGAGAAGTTCACCCACCTACACTTCTTCTTCCATGATGTCGTGACGGGCCCAAAGCCCAGCATGGTGTTTGTCGCCGAGCCCAACGGGAAAGCGAAGGATGCCCTTCCGTTCGGAACGGTGGTGGCGATGGATGACCCTTTAACCGTGGGGCCCGATCATGACTCGAAACTTGTGGGCAAGGCACAAGGAATTTACACTTCAATATCGCAGGAAGAGATGGGGCTAATGATGGTGATGACGATGGCGTTCACCGATGGAGAGTTCAACGGAAGCACCATCAGTGTTTTGGGGAGGAACATGATCATGAGTGAACCTGTTAGGGAAATGGCTATTGTTGGTGGCACGGGGGCTTTTAGGTTTGCACGTGGCTACGCTCAGGCAAAGTTTTACTCTGTTGATTTCACCAAAGGAGATGCTATCGTGGAATACGATGTATTCGTCAACCATTATTAA
Predicted protein sequences of Glyma.19g151100
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.19g151100.1.p sequence-type=predicted peptide transcript=Glyma.19g151100.1 locus=Glyma.19g151100 ID=Glyma.19g151100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAKSTFFICLNLSLLFSLVTATYYSSLTPTLLGFREEKFTHLHFFFHDVVTGPKPSMVFVAEPNGKAKDALPFGTVVAMDDPLTVGPDHDSKLVGKAQGIYTSISQEEMGLMMVMTMAFTDGEFNGSTISVLGRNMIMSEPVREMAIVGGTGAFRFARGYAQAKFYSVDFTKGDAIVEYDVFVNHY*