|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G14980.1 | AT | chaperonin 10 | JGI | N/A | IEA |
GO:0006457 | GO-bp | protein folding | EnsemblGenomes | N/A | IEA |
GO:0006457 | GO-bp | protein folding | JGI | N/A | IEA |
GO:0006986 | GO-bp | response to unfolded protein | EnsemblGenomes | N/A | IEA |
GO:0051085 | GO-bp | chaperone cofactor-dependent protein refolding | EnsemblGenomes | N/A | IEA |
GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
GO:0005737 | GO-cc | cytoplasm | JGI | N/A | IEA |
GO:0005759 | GO-cc | mitochondrial matrix | EnsemblGenomes | N/A | IEA |
GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
GO:0051082 | GO-mf | unfolded protein binding | EnsemblGenomes | N/A | IEA |
GO:0051087 | GO-mf | chaperone binding | EnsemblGenomes | N/A | IEA |
KOG1641 | KOG | Mitochondrial chaperonin | JGI | N/A | IEA |
PTHR10772 | Panther | 10 KDA HEAT SHOCK PROTEIN | JGI | N/A | IEA |
PF00166 | PFAM | Chaperonin 10 Kd subunit | JGI | N/A | IEA |
Glyma.19g128300 not represented in the dataset |
Glyma.19g128300 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.03g125800 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma19g30860 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.19g128300.1 sequence-type=CDS polypeptide=Glyma.19g128300.1.p locus=Glyma.19g128300 ID=Glyma.19g128300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCGAAGCGTTTGATTCCTCTGTTCAATCGGGTTTTGGTGGAGAAAATCGTGCCTCCATCGAAGACCACCGCTGGCATTTTGTTACCCGAGAAATCCACCAAGCTGAATTCCGGAAAAGTTATTGCTGTTGGCCCTGGCTTTCACAGTAAGGATGGGAAGCTAATTCCTGTGGCTGTAAAGGAAGGTGACACTGTTCTTTTGCCTGAATATGGGGGAACTGAGGTGAAGCTTGATAACAAAGAGTATCATCTGTTTAGAGACGATGATATACTGGGGACATTGCATGATTGA
>Glyma.19g128300.1.p sequence-type=predicted peptide transcript=Glyma.19g128300.1 locus=Glyma.19g128300 ID=Glyma.19g128300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAKRLIPLFNRVLVEKIVPPSKTTAGILLPEKSTKLNSGKVIAVGPGFHSKDGKLIPVAVKEGDTVLLPEYGGTEVKLDNKEYHLFRDDDILGTLHD*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||