SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.19g118800

Feature Type:gene_model
Chromosome:Gm19
Start:37643375
stop:37647739
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G03240.1AT frataxin homolog JGI N/AIEA
GO:0006879GO-bp cellular iron ion homeostasis EnsemblGenomesN/AIEA
GO:0007005GO-bp mitochondrion organization EnsemblGenomesN/AIEA
GO:0016226GO-bp iron-sulfur cluster assembly EnsemblGenomesN/AIEA
GO:0016226GO-bp iron-sulfur cluster assembly JGI N/AIEA
GO:0018283GO-bp iron incorporation into metallo-sulfur cluster EnsemblGenomesN/AIEA
GO:0034599GO-bp cellular response to oxidative stress EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0005739GO-cc mitochondrion EnsemblGenomesN/AIEA
GO:0004322GO-mf ferroxidase activity EnsemblGenomesN/AIEA
GO:0008198GO-mf ferrous iron binding EnsemblGenomesN/AIEA
GO:0008199GO-mf ferric iron binding EnsemblGenomesN/AIEA
GO:0008199GO-mf ferric iron binding JGI N/AIEA
GO:0034986GO-mf iron chaperone activity EnsemblGenomesN/AIEA
GO:0051537GO-mf 2 iron, 2 sulfur cluster binding EnsemblGenomesN/AIEA
KOG3413 KOG Mitochondrial matrix protein frataxin, involved in Fe/S protein biosynthesis JGI N/AIEA
PTHR16821Panther FRATAXIN JGI N/AIEA
PF01491PFAM Frataxin-like domain JGI N/AIEA
GN7V-53833SoyCyc9-rxn ferroxidase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.03g007300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma19g29700 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.19g118800.1 sequence-type=CDS polypeptide=Glyma.19g118800.1.p locus=Glyma.19g118800 ID=Glyma.19g118800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCCTCAAAGCTGCTTTTGAAGAGAAGGCTCTTTAGGTTTTTGCAACTGTCACAACCTTCTTTTTCTTCCATTCATGCAGCCCCAATCCTTTCTGTAAAAGCTTCAGAATTCATGTTCCCCTACAAGGAGAATGCCCTTCTTCCTCCTCTCTCTTCTTCTTCTAGAAACTTCTGCTCTCGCAGTTTTAATCTTGATGAATCTCAAGGCCCCCTGACTATTGATTACAGTTCTCTACTGCAGGAGGGTGAATTCCACAGACTGGCTGATTCCACAATACATAGCCTCCAAGAGAAATTAGAGGACTATGGAGACTCAGTTGAAGTTGATGGATTTGACATAGACTACGGCAATGATGTTTTGACTATAAAACTTGGCGATCTTGGCACCTATGTATTGAACAAACAAACACCAAATAGACAACTTTGGCTGTCTTCTCCAGTGAGTGGTCCTTCAAGGTTTGATTGGGATCGGGATACTAAAGCTTGGATTTATAGGCGGAACAAAGCAAACTTGTATAAAATTTTGGAAGGCGAGTTTGAGCAGTTATGTGGCAAACCTATTGATCTTTCCTAA

>Glyma.19g118800.1.p sequence-type=predicted peptide transcript=Glyma.19g118800.1 locus=Glyma.19g118800 ID=Glyma.19g118800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASKLLLKRRLFRFLQLSQPSFSSIHAAPILSVKASEFMFPYKENALLPPLSSSSRNFCSRSFNLDESQGPLTIDYSSLLQEGEFHRLADSTIHSLQEKLEDYGDSVEVDGFDIDYGNDVLTIKLGDLGTYVLNKQTPNRQLWLSSPVSGPSRFDWDRDTKAWIYRRNKANLYKILEGEFEQLCGKPIDLS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo