SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.19g109600

Feature Type:gene_model
Chromosome:Gm19
Start:36339692
stop:36340144
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.19g109600
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00140.1AT ATP synthase subunit C family protein JGI N/AIEA
GO:0006811GO-bp ion transport EnsemblGenomesN/AIEA
GO:0015986GO-bp ATP synthesis coupled proton transport EnsemblGenomesN/AIEA
GO:0015991GO-bp ATP hydrolysis coupled proton transport EnsemblGenomesN/AIEA
GO:0015991GO-bp ATP hydrolysis coupled proton transport JGI N/AIEA
GO:0009535GO-cc chloroplast thylakoid membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0033177GO-cc proton-transporting two-sector ATPase complex, proton-transporting domain EnsemblGenomesN/AIEA
GO:0033177GO-cc proton-transporting two-sector ATPase complex, proton-transporting domain JGI N/AIEA
GO:0045263GO-cc proton-transporting ATP synthase complex, coupling factor F(o) EnsemblGenomesN/AIEA
GO:0008289GO-mf lipid binding EnsemblGenomesN/AIEA
GO:0015078GO-mf proton transmembrane transporter activity EnsemblGenomesN/AIEA
GO:0015078GO-mf hydrogen ion transmembrane transporter activity JGI N/AIEA
GO:0046933GO-mf proton-transporting ATP synthase activity, rotational mechanism EnsemblGenomesN/AIEA
PF00137PFAM ATP synthase subunit C JGI N/AIEA

Expression Patterns of Glyma.19g109600
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.19g109600 not represented in the dataset
Glyma.19g109600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.19g109600 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma19g28574 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.19g109600
>Glyma.19g109600.1 sequence-type=CDS polypeptide=Glyma.19g109600.1.p locus=Glyma.19g109600 ID=Glyma.19g109600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAATCTAATTATTTTTGCTGCTTTTGTTATTGCTGCTGGATTGACCGTAGGACTTGCTTCTATTGGACCTGGGGTTGAAGGGATTGCACGACAACCAAAGACAAAGGGAAAAATACGAGGTACTTTATTGCTTAGTTTGGTTTTTATGGAAGCTTTAACAATTTATGGACTGGTTGTAGCATTAACACTTTTATTTGCTAATCCTTTTGTTTAA
Predicted protein sequences of Glyma.19g109600
>Glyma.19g109600.1.p sequence-type=predicted peptide transcript=Glyma.19g109600.1 locus=Glyma.19g109600 ID=Glyma.19g109600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MNLIIFAAFVIAAGLTVGLASIGPGVEGIARQPKTKGKIRGTLLLSLVFMEALTIYGLVVALTLLFANPFV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo