SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.19g106700

Feature Type:gene_model
Chromosome:Gm19
Start:35786521
stop:35788815
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.19g106700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13870.1AT xyloglucan endotransglucosylase/hydrolase 5 JGI N/AIEA
GO:0005975GO-bp carbohydrate metabolic process EnsemblGenomesN/AIEA
GO:0005975GO-bp carbohydrate metabolic process JGI N/AIEA
GO:0006073GO-bp cellular glucan metabolic process EnsemblGenomesN/AIEA
GO:0006073GO-bp cellular glucan metabolic process JGI N/AIEA
GO:0008152GO-bp metabolic process EnsemblGenomesN/AIEA
GO:0010411GO-bp xyloglucan metabolic process EnsemblGenomesN/AIEA
GO:0042546GO-bp cell wall biogenesis EnsemblGenomesN/AIEA
GO:0071555GO-bp cell wall organization EnsemblGenomesN/AIEA
GO:0005576GO-cc extracellular region EnsemblGenomesN/AIEA
GO:0005618GO-cc cell wall EnsemblGenomesN/AIEA
GO:0005618GO-cc cell wall JGI N/AIEA
GO:0048046GO-cc apoplast EnsemblGenomesN/AIEA
GO:0048046GO-cc apoplast JGI N/AIEA
GO:0004553GO-mf hydrolase activity, hydrolyzing O-glycosyl compounds EnsemblGenomesN/AIEA
GO:0004553GO-mf hydrolase activity, hydrolyzing O-glycosyl compounds JGI N/AIEA
GO:0016740GO-mf transferase activity EnsemblGenomesN/AIEA
GO:0016762GO-mf xyloglucan:xyloglucosyl transferase activity EnsemblGenomesN/AIEA
GO:0016762GO-mf xyloglucan:xyloglucosyl transferase activity JGI N/AIEA
GO:0016787GO-mf hydrolase activity EnsemblGenomesN/AIEA
GO:0016798GO-mf hydrolase activity, acting on glycosyl bonds EnsemblGenomesN/AIEA
PF00722PFAM Glycosyl hydrolases family 16 JGI N/AIEA
PF06955PFAM Xyloglucan endo-transglycosylase (XET) C-terminus JGI N/AIEA
GN7V-45995SoyCyc9-rxn xyloglucan:xyloglucosyl transferase Plant Metabolic Network ISS

Expression Patterns of Glyma.19g106700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.19g106700
ParalogEvidenceComments
Glyma.16g045000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.19g106700 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma19g28220 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.19g106700
>Glyma.19g106700.1 sequence-type=CDS polypeptide=Glyma.19g106700.1.p locus=Glyma.19g106700 ID=Glyma.19g106700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGTTCTTCTTCTTCCATATGGACCGTGTGTTTGATTTTGGCATCACTGGCCTCTGCAGCACTCTGTGCCAACCCTCGTAGACCAGTGGATGTACAATTTGGCCGAAACTACGTGCCCACATGGGCCTTTGATCACATCAAATACTTCAATGGAGGTTCTGACATTCAGCTTCATCTTGACAAGTACACTGGTACTGGCTTCCAGTCCAAAGGGTCATACTTGTTTGGTCACTTCAGCATGTACATAAAGATGGTTCCTGGAGATTCAGCTGGCACAGTCACTGCTTTCTATTTATCTTCCCAAAATGCGGAGCACGACGAGATAGACTTTGAGTTCTTGGGGAACAGAACAGGACAACCTTACATTTTGCAAACAAATGTTTTCACAGGAGGCAAGGGTGACAGAGAGCAAAGAATCTATCTCTGGTTTGATCCCACAAAAGAATACCACAGATACTCCATTCTCTGGAACTTGTATCAGATTGTGTTCTTTGTGGACGATGTGGCAATCAGGGTGTTCAAGAACAGCAAGGACTTGGGAGTGAAATTCCCCTTCGACCAGCCAATGAAGATCTACAACAGTCTATGGAACGCTGATGACTGGGCCACAAGGGGTGGTTTGGAGAAAACGGATTGGTCCAAAGCCCCATTCATAGCAGCCTACAAGGGGTTCCACATCGACGGGTGCGAGGCCTCGGTGAACGCCAAGTTCTGCGACACGCAGGGCAAGAGCTGGTGGGACCAACCAGAATTCCGTGACCTCGACGCTTCCCAGTGGCGTAGCCTCAGATGGGTGCGCCAGAAATACACCATCTACAACTACTGCACTGACAGAAAACGCTACCCTCAACTCTCCCCTGAGTGCAAACCAGACCGTGACATTTAA
Predicted protein sequences of Glyma.19g106700
>Glyma.19g106700.1.p sequence-type=predicted peptide transcript=Glyma.19g106700.1 locus=Glyma.19g106700 ID=Glyma.19g106700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGSSSSIWTVCLILASLASAALCANPRRPVDVQFGRNYVPTWAFDHIKYFNGGSDIQLHLDKYTGTGFQSKGSYLFGHFSMYIKMVPGDSAGTVTAFYLSSQNAEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKEYHRYSILWNLYQIVFFVDDVAIRVFKNSKDLGVKFPFDQPMKIYNSLWNADDWATRGGLEKTDWSKAPFIAAYKGFHIDGCEASVNAKFCDTQGKSWWDQPEFRDLDASQWRSLRWVRQKYTIYNYCTDRKRYPQLSPECKPDRDI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo