Report for Sequence Feature Glyma.19g104800
| Feature Type: | gene_model |
| Chromosome: | Gm19 |
| Start: | 35911871 |
| stop: | 35914085 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.19g104800
Gene model name correspondences to Glyma.19g104800 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.19g104800
>Glyma.19g104800.2 sequence-type=CDS polypeptide=Glyma.19g104800.2.p locus=Glyma.19g104800 id=Glyma.19g104800.2.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGATTGGGTACAAATGGACCGTTGTCGTGTAGCAGCATTGTTGCCTTCGATCAAGGAGAAACAACTAGAGAGTCATAGTAATTGTGTTAGACATGATCGAGAAAACCAAGGTCTTGATAAAGGGAATATGGCTGAAATTGATGGCTATCAAAACTTGTTTGGTTTGATGAAACAGAGGTTTCTGAGTTTCAAGAACCAAAAATATATAAAAGAGTTGGAGCATTTTCAAGCCCTTGCTGAAGCTCAATTTCCAAAGGAGGCAGACAATGTTGGGAGCAGCTTGGCATATGGCCTATGCTAG
Predicted protein sequences of Glyma.19g104800
>Glyma.19g104800.2.p sequence-type=predicted peptide transcript=Glyma.19g104800.2 locus=Glyma.19g104800 id=Glyma.19g104800.2.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MDWVQMDRCRVAALLPSIKEKQLESHSNCVRHDRENQGLDKGNMAEIDGYQNLFGLMKQRFLSFKNQKYIKELEHFQALAEAQFPKEADNVGSSLAYGLC*