SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.19g089400

Feature Type:gene_model
Chromosome:Gm19
Start:31896238
stop:31897829
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.19g089400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G06860.1AT multifunctional protein 2 JGI N/AIEA
GO:0006631GO-bp fatty acid metabolic process EnsemblGenomesN/AIEA
GO:0006631GO-bp fatty acid metabolic process JGI N/AIEA
GO:0006635GO-bp fatty acid beta-oxidation EnsemblGenomesN/AIEA
GO:0008152GO-bp metabolic process EnsemblGenomesN/AIEA
GO:0008152GO-bp metabolic process JGI N/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0005777GO-cc peroxisome EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0003824GO-mf catalytic activity EnsemblGenomesN/AIEA
GO:0003824GO-mf catalytic activity JGI N/AIEA
GO:0003857GO-mf 3-hydroxyacyl-CoA dehydrogenase activity EnsemblGenomesN/AIEA
GO:0003857GO-mf 3-hydroxyacyl-CoA dehydrogenase activity JGI N/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity JGI N/AIEA
PTHR23309Panther 3-HYDROXYACYL-COA DEHYROGENASE JGI N/AIEA
PF00378PFAM Enoyl-CoA hydratase/isomerase family JGI N/AIEA
PF02737PFAM 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain JGI N/AIEA
PWY-5136SoyCyc9 fatty acid β-oxidation II (peroxisome) Plant Metabolic Network ISS
PWY-5137SoyCyc9 fatty acid β-oxidation III (unsaturated, odd number) Plant Metabolic Network ISS
PWY-5138SoyCyc9 unsaturated, even numbered fatty acid β-oxidation Plant Metabolic Network ISS
PWY-561SoyCyc9 superpathway of glyoxylate cycle and fatty acid degradation Plant Metabolic Network ISS
PWY-6837SoyCyc9 fatty acid beta-oxidation V (unsaturated, odd number, di-isomerase-dependent) Plant Metabolic Network ISS
PWY-7036SoyCyc9 very long chain fatty acid biosynthesis II Plant Metabolic Network ISS
GN7V-64303SoyCyc9-rxn enoyl-CoA isomerase Plant Metabolic Network ISS

Expression Patterns of Glyma.19g089400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.19g089400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma19g25650 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.19g089400
>Glyma.19g089400.1 sequence-type=CDS polypeptide=Glyma.19g089400.1.p locus=Glyma.19g089400 ID=Glyma.19g089400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTATGATGGGTGCACATTTTCTAATTCTTTCCTCTCCCTTCTTATAGAGCATCCAAAACCTGCGGCTAGGAAACCATCAGATGTTGCCATTGATGGTCTTGCCTTGGATGGAGGCTTAGAAGTTGCAATGGCATGCAATGCTCGGTTATCAACTCCAACTACTCAGCTAGGCTTGCCTAAACTTCAGCTTGGAATAATTCCTGGATTTGGAGGAACACAGCGACTTCCTCGTCTTGTTGGTTTGACAAAGGGACTTGAGATGATACTGGTATACTACATTTTTGAAGTTGTACCTGGGGTTACAGATTGTGGTCTGGTTCCAAGACAAGTCAAGAAGCTTGCCATCATTGGCGGAGGACTAATGGGCTCTGGAATAGCAACTGCTTTAATTCTTAGCAACTATACTGTCATCTTGAATGAAGTAAATGAGAAGTTCTTAGATGTTGGTATGAATAGGATTAAAGGAAACCTACAAAACTGTGTTAAGAAAGGTAAATTGACCAAGGAAAATTTTGAAAAGACCATCTCTCTTATCAAAGGTATGAATAATGTCTTTCATAAACAATATTTTAAACTAACATGCATCAACCATTCATTGCCTTATGTGAAACTTTTGGTTTCCTTTCCTTTGCCTACTTTTATATTTCTAGCTTCTCTTCTGGTTTCCTTTGAAGCTGATAAAGAGCAATTGGGATAA
Predicted protein sequences of Glyma.19g089400
>Glyma.19g089400.1.p sequence-type=predicted peptide transcript=Glyma.19g089400.1 locus=Glyma.19g089400 ID=Glyma.19g089400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MYDGCTFSNSFLSLLIEHPKPAARKPSDVAIDGLALDGGLEVAMACNARLSTPTTQLGLPKLQLGIIPGFGGTQRLPRLVGLTKGLEMILVYYIFEVVPGVTDCGLVPRQVKKLAIIGGGLMGSGIATALILSNYTVILNEVNEKFLDVGMNRIKGNLQNCVKKGKLTKENFEKTISLIKGMNNVFHKQYFKLTCINHSLPYVKLLVSFPLPTFIFLASLLVSFEADKEQLG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo