| 
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT2G07681.1 | AT | Cytochrome C assembly protein | JGI | N/A | IEA | 
| GO:0008535 | GO-bp | respiratory chain complex IV assembly | JGI | N/A | IEA | 
| GO:0015886 | GO-bp | heme transport | EnsemblGenomes | N/A | IEA | 
| GO:0017004 | GO-bp | cytochrome complex assembly | EnsemblGenomes | N/A | IEA | 
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA | 
| GO:0005739 | GO-cc | mitochondrion | EnsemblGenomes | N/A | IEA | 
| GO:0005886 | GO-cc | plasma membrane | EnsemblGenomes | N/A | IEA | 
| GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA | 
| GO:0016020 | GO-cc | membrane | JGI | N/A | IEA | 
| GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA | 
| GO:0031966 | GO-cc | mitochondrial membrane | EnsemblGenomes | N/A | IEA | 
| GO:0015232 | GO-mf | heme transporter activity | EnsemblGenomes | N/A | IEA | 
| GO:0020037 | GO-mf | heme binding | EnsemblGenomes | N/A | IEA | 
| PF01578 | PFAM | Cytochrome C assembly protein | JGI | N/A | IEA | 
| 
			 Glyma.19g075000 not represented in the dataset  | 
			 Glyma.19g075000 not represented in the dataset  | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection  | 
			Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome  | 
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|---|---|---|
| Glyma19g22380 | Wm82.a1.v1.1 | IGC | As supplied by JGI | 
>Glyma.19g075000.1 sequence-type=CDS polypeptide=Glyma.19g075000.1.p locus=Glyma.19g075000 ID=Glyma.19g075000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTGGGGCACCTTTTGGGTGTGGGATGCTCGTTTAACCTCTGTATTCATCTCGTTTCTGATTTACCTGGGTGCACTGCGTTTTCAAAAGCTTCCTGTCGAACCGGCTCCTATTTCAATCCGTGCTGGACCGATCGATATACCAATAATCAAGTCTTCAGTCAACTGGTGGAATACATTACATCAACCTGGGAGCATTAGCCGATCTGGTACATCAATCTTAAAGTGCTAA
>Glyma.19g075000.1.p sequence-type=predicted peptide transcript=Glyma.19g075000.1 locus=Glyma.19g075000 ID=Glyma.19g075000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MWGTFWVWDARLTSVFISFLIYLGALRFQKLPVEPAPISIRAGPIDIPIIKSSVNWWNTLHQPGSISRSGTSILKC*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||