SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.19g068500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.19g068500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.19g068500

Feature Type:gene_model
Chromosome:Gm19
Start:20969006
stop:20969859
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74030.1AT enolase 1 JGI N/AIEA
GO:0006096GO-bp glycolytic process EnsemblGenomesN/AIEA
GO:0006096GO-bp glycolysis JGI N/AIEA
GO:0000015GO-cc phosphopyruvate hydratase complex EnsemblGenomesN/AIEA
GO:0000015GO-cc phosphopyruvate hydratase complex JGI N/AIEA
GO:0000287GO-mf magnesium ion binding EnsemblGenomesN/AIEA
GO:0000287GO-mf magnesium ion binding JGI N/AIEA
GO:0004634GO-mf phosphopyruvate hydratase activity EnsemblGenomesN/AIEA
GO:0004634GO-mf phosphopyruvate hydratase activity JGI N/AIEA
PTHR11902Panther ENOLASE JGI N/AIEA
PF00113PFAM Enolase, C-terminal TIM barrel domain JGI N/AIEA
PF03952PFAM Enolase, N-terminal domain JGI N/AIEA
GLUCONEO-PWYSoyCyc9 gluconeogenesis I Plant Metabolic Network ISS
GLYCOLYSISSoyCyc9 glycolysis I (from glucose 6-phosphate) Plant Metabolic Network ISS
PWY-1042SoyCyc9 glycolysis IV (plant cytosol) Plant Metabolic Network ISS
PWY-5464SoyCyc9 superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle Plant Metabolic Network ISS
PWY-5484SoyCyc9 glycolysis II (from fructose 6-phosphate) Plant Metabolic Network ISS
PWY-5723SoyCyc9 Rubisco shunt Plant Metabolic Network ISS
PWY-7345SoyCyc9 superpathway of anaerobic sucrose degradation Plant Metabolic Network ISS
GN7V-44854SoyCyc9-rxn phosphopyruvate hydratase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.19g068500 not represented in the dataset

Glyma.19g068500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma19g12490 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.19g068500.1 sequence-type=CDS polypeptide=Glyma.19g068500.1.p locus=Glyma.19g068500 ID=Glyma.19g068500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTCTGTGTTTGTCAAGGAATCAAGCTGATGTTGATGCTATTATGCTGGAAATTGATGGAACTCCTAACAAATCAAAACTAGGGGCTAATGCAATATTGGGAGTTTCGCTGAGTGTATGTAGAATTGGTGCAGGGGCAAAGGGAGTGCCCTTGTACAGGCACATCCAGGAGATTTCAGGAACAAAAGAACTTGTTATGCCAGTTCCAGCTTTCAATGTTATAAATAAGGGTAGTCATGCTAGGAATAATCTGGCTATGCAAGAGTTTATGATACTACCAGTTGGAGCAACTTCATTTGCTGAGGCTCTCCGCACGGGCAGTGAAGTTTATCATGTATTAAAGGGAATAATCAAGGAAAAATATGTCCAACATGCATGTAATGTTGAAGATGAAGGAGGGTTTGCTCCCAATGTTCAAGATAACAGGGAGGGGCTTGTTTTACTCATGGATGCCATTGAGAAGGCTGGTTATGCTGGCTTTGGAAGCTGTTGA

>Glyma.19g068500.1.p sequence-type=predicted peptide transcript=Glyma.19g068500.1 locus=Glyma.19g068500 ID=Glyma.19g068500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MALCLSRNQADVDAIMLEIDGTPNKSKLGANAILGVSLSVCRIGAGAKGVPLYRHIQEISGTKELVMPVPAFNVINKGSHARNNLAMQEFMILPVGATSFAEALRTGSEVYHVLKGIIKEKYVQHACNVEDEGGFAPNVQDNREGLVLLMDAIEKAGYAGFGSC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo