Glyma.19g054200

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.19g054200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.19g054200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.19g054200

Feature Type:	gene_model
Chromosome:	Gm19
Start:	8965354
stop:	8967732
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.19g054200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00150.1	AT	ATPase, F0 complex, subunit A protein	JGI	N/A	IEA
GO:0006754	GO-bp	ATP biosynthetic process	EnsemblGenomes	N/A	IEA
GO:0006811	GO-bp	ion transport	EnsemblGenomes	N/A	IEA
GO:0015986	GO-bp	ATP synthesis coupled proton transport	EnsemblGenomes	N/A	IEA
GO:0015986	GO-bp	ATP synthesis coupled proton transport	JGI	N/A	IEA
GO:0099132	GO-bp	ATP hydrolysis coupled cation transmembrane transport	EnsemblGenomes	N/A	IEA
GO:0009507	GO-cc	chloroplast	EnsemblGenomes	N/A	IEA
GO:0009535	GO-cc	chloroplast thylakoid membrane	EnsemblGenomes	N/A	IEA
GO:0009536	GO-cc	plastid	EnsemblGenomes	N/A	IEA
GO:0009544	GO-cc	chloroplast ATP synthase complex	EnsemblGenomes	N/A	IEA
GO:0009579	GO-cc	thylakoid	EnsemblGenomes	N/A	IEA
GO:0016020	GO-cc	membrane	EnsemblGenomes	N/A	IEA
GO:0016021	GO-cc	integral component of membrane	EnsemblGenomes	N/A	IEA
GO:0045263	GO-cc	proton-transporting ATP synthase complex, coupling factor F(o)	EnsemblGenomes	N/A	IEA
GO:0045263	GO-cc	proton-transporting ATP synthase complex, coupling factor F(o)	JGI	N/A	IEA
GO:0015078	GO-mf	proton transmembrane transporter activity	EnsemblGenomes	N/A	IEA
GO:0015078	GO-mf	hydrogen ion transmembrane transporter activity	JGI	N/A	IEA
GO:0046933	GO-mf	proton-transporting ATP synthase activity, rotational mechanism	EnsemblGenomes	N/A	IEA
PTHR11410	Panther	ATP SYNTHASE SUBUNIT A	JGI	N/A	IEA
PF00119	PFAM	ATP synthase A chain	JGI	N/A	IEA
PWY-7219	SoyCyc9	adenosine ribonucleotides de novo biosynthesis	Plant Metabolic Network		ISS
PWY-7229	SoyCyc9	superpathway of adenosine nucleotides de novo biosynthesis I	Plant Metabolic Network		ISS
PWY-841	SoyCyc9	superpathway of purine nucleotides de novo biosynthesis I	Plant Metabolic Network		ISS

Expression Patterns of Glyma.19g054200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.19g054200 not represented in the dataset	Glyma.19g054200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.19g054200 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma19g07557	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.19g054200

Limit To All Plant Sequences

>Glyma.19g054200.1 sequence-type=CDS polypeptide=Glyma.19g054200.1.p locus=Glyma.19g054200 ID=Glyma.19g054200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTCAGTCACTAGACGAGGTAGAGAGAGGCCAGGTCACAAACGACTAGCTTATTTTAATAAATACATCCAACCAACCTCAATCCTTTTACCGATTAACATCTTAGAAGATTTCACAAAACCCTTATCTCTTAGTTTTCGACTTTTCAAAAATATATTAGCTGATGAAGTAGTAGTTGTTGTTCTTGTTTCTTTAGTATCTTTAGTAATTCCTATACCTATCATGTTCCTTGGATTATTCACAAGCGGTATTCAAGCTCTCATTTTTGCTACTTTAGATGCGGCTTATATAGGTGAATCCATGGAAGGCCATCATTGA

Predicted protein sequences of Glyma.19g054200

Limit To All Plant Sequences

>Glyma.19g054200.1.p sequence-type=predicted peptide transcript=Glyma.19g054200.1 locus=Glyma.19g054200 ID=Glyma.19g054200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSVTRRGRERPGHKRLAYFNKYIQPTSILLPINILEDFTKPLSLSFRLFKNILADEVVVVVLVSLVSLVIPIPIMFLGLFTSGIQALIFATLDAAYIGESMEGHH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain