|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G16857.2 | AT | response regulator 1 | JGI | N/A | IEA |
GO:0000160 | GO-bp | phosphorelay signal transduction system | EnsemblGenomes | N/A | IEA |
GO:0000160 | GO-bp | phosphorelay signal transduction system | JGI | N/A | IEA |
GO:0006355 | GO-bp | regulation of transcription, DNA-templated | JGI | N/A | IEA |
GO:0005622 | GO-cc | intracellular | EnsemblGenomes | N/A | IEA |
GO:0000156 | GO-mf | phosphorelay response regulator activity | JGI | N/A | IEA |
PF00072 | PFAM | Response regulator receiver domain | JGI | N/A | IEA |
Glyma.19g051800 not represented in the dataset |
Glyma.19g051800 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma19g07174 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.19g051800.1 sequence-type=CDS polypeptide=Glyma.19g051800.1.p locus=Glyma.19g051800 ID=Glyma.19g051800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTCTCACTTGCAGTGCTTCTCGGACATGTGCGCAAGTTTTTGCTCCGGATCCCAAAAATGTCGGAGACGGCACTGCTCACTTGAAGAGTATGTTCGGGAGAAAACACATTGCATTGATGTGATACTCATTGAAGTTCACATGCCATATGTCGATAGCCTTCAATTCCTTCAGCATGTCACTAACGAAACTAATGTTCCAGTTATCATGATGTCTCTTGATGATGCTCAGAGTACTGTGATGAAGGCTATTAGAAATGGAGCTTGCAATTATTGGCTTAAGCCTTTGCAAGAGAGCCTAATCAAGGTTATGTGGATGGAATATGCTAGGAAACTCGAGTCAAAATATGCTACCAAGAAAAGAAGATTCTGA
>Glyma.19g051800.1.p sequence-type=predicted peptide transcript=Glyma.19g051800.1 locus=Glyma.19g051800 ID=Glyma.19g051800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MSHLQCFSDMCASFCSGSQKCRRRHCSLEEYVREKTHCIDVILIEVHMPYVDSLQFLQHVTNETNVPVIMMSLDDAQSTVMKAIRNGACNYWLKPLQESLIKVMWMEYARKLESKYATKKRRF*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||