|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G05980.1 | AT | DHFS-FPGS homolog B | JGI | N/A | IEA |
GO:0009058 | GO-bp | biosynthetic process | EnsemblGenomes | N/A | IEA |
GO:0009396 | GO-bp | folic acid-containing compound biosynthetic process | EnsemblGenomes | N/A | IEA |
GO:0046901 | GO-bp | tetrahydrofolylpolyglutamate biosynthetic process | EnsemblGenomes | N/A | IEA |
GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
GO:0004326 | GO-mf | tetrahydrofolylpolyglutamate synthase activity | EnsemblGenomes | N/A | IEA |
GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
GO:0016874 | GO-mf | ligase activity | EnsemblGenomes | N/A | IEA |
PWY-2161 | SoyCyc9 | folate polyglutamylation | Plant Metabolic Network | ISS | |
PWY-2161B-PMN | SoyCyc9 | folate polyglutamylation II | Plant Metabolic Network | ISS | |
GN7V-53845 | SoyCyc9-rxn | 10-formyl-tetrahydrofolylpolyglutamate synthetase | Plant Metabolic Network | ISS |
Glyma.19g044100 not represented in the dataset |
Glyma.19g044100 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma19g05877 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.19g044100.1 sequence-type=CDS polypeptide=Glyma.19g044100.1.p locus=Glyma.19g044100 ID=Glyma.19g044100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTTGCATGTTATCAAGTCGTGTCTCCATACTTTCTGTTGGCTTCTTGAAGACTCGTACTTGAAACATATACAACACACTTTACCAAAGAAGTTCATAAAAGGGTTAACAACTACGAGTTTGCAAGGAAGGGCTCAGATTGTTCCTGATCAGTTCATCAATGATGAAATACCAAATGAACTTGTCTTCTTTTTAGATGGGGCTCATAGTCCTGAAAGCATGGAAGCATGCACTAAGTGGTTTTCTCTTGCTATTAAAGATGAAGACCAGATTTTGTTTCATCAAAAACCTGATAATTCTAACTTCTCAAGTAGTGAAGATGCACAATTGTGA
>Glyma.19g044100.1.p sequence-type=predicted peptide transcript=Glyma.19g044100.1 locus=Glyma.19g044100 ID=Glyma.19g044100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MLHVIKSCLHTFCWLLEDSYLKHIQHTLPKKFIKGLTTTSLQGRAQIVPDQFINDEIPNELVFFLDGAHSPESMEACTKWFSLAIKDEDQILFHQKPDNSNFSSSEDAQL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||