Glyma.19g024900

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.19g024900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.19g024900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.19g024900

Feature Type:	gene_model
Chromosome:	Gm19
Start:	3077837
stop:	3080961
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.19g024900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G44190.1	AT	FAD/NAD(P)-binding oxidoreductase family protein	JGI	N/A	IEA
GO:0055114	GO-bp	oxidation-reduction process	EnsemblGenomes	N/A	IEA
GO:0055114	GO-bp	oxidation-reduction process	JGI	N/A	IEA
GO:0016491	GO-mf	oxidoreductase activity	EnsemblGenomes	N/A	IEA
GO:0016491	GO-mf	oxidoreductase activity	JGI	N/A	IEA
PTHR22915	Panther	NADH DEHYDROGENASE-RELATED	JGI	N/A	IEA
PTHR22915:SF5	Panther	APOPTOSIS-INDUCING FACTOR 2	JGI	N/A	IEA
PF07992	PFAM	Pyridine nucleotide-disulphide oxidoreductase	JGI	N/A	IEA
GLYCLEAV-PWY	SoyCyc9	glycine cleavage	Plant Metabolic Network		ISS
PWY-5046	SoyCyc9	2-oxoisovalerate decarboxylation to isobutanoyl-CoA	Plant Metabolic Network		ISS
PWY-5084	SoyCyc9	2-oxoglutarate decarboxylation to succinyl-CoA	Plant Metabolic Network		ISS
PWY-5173	SoyCyc9	superpathway of acetyl-CoA biosynthesis	Plant Metabolic Network		ISS
PWY-5464	SoyCyc9	superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle	Plant Metabolic Network		ISS
PYRUVDEHYD-PWY	SoyCyc9	pyruvate decarboxylation to acetyl CoA	Plant Metabolic Network		ISS
GN7V-66877	SoyCyc9-rxn	dihydrolipoyl dehydrogenase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.19g024900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.19g024900 not represented in the dataset	Glyma.19g024900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.19g024900 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma19g02940	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.19g024900

Limit To All Plant Sequences

>Glyma.19g024900.1 sequence-type=CDS polypeptide=Glyma.19g024900.1.p locus=Glyma.19g024900 ID=Glyma.19g024900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTCTTCTACAGCCAAAATATTTGCCAAGCTTCATTACAAACCAATCCAAAAGAAAACATCATTGAAGATAAAATTTGATCAGTCCATTCTGATTATTGGAGGAGGTCCCACTGGTGTGGAACTTGCTGGAGCAAGGCTTACACTAGTGCACAAAGGAGCAAGGCTTCTGGAATTCGTAGGGGCAAAAGCCGAGGATAAGACTCTAAATTGGTTGAAATCAAAGAATGTTGTGGTCAAACTAGAGCAATCAAAGATATATCAAACTTCAAATGGAGGGACCATTGAGGCAGATTGTCATTTCTTATGTATAGGGAAACCACTTGCTTCAGCATGGCTTAAGGAAACTGTGTTGAAGAATGACTTGGATGGTCAAGGTAGGATCAAGGTAGATGAAAGATTGAGGGTCAAGGGCCGGAACAACATTTTTGCAATTGGAGATGTTACAGACATTCCGGAAATCAAGCAAGGGTTTTTGGCACAACAACAGCTTGAAGTGGTTGTGAAGAACTTAAATTTACCATTCTTGACAATAAGTGGAAGAATTCCAGGATTCATCAAGTCTAGAGATTTGTTTGTTGGTAAAACAAGAAAACAAATGGGACTCAATCCTGTACACATTTGA

Predicted protein sequences of Glyma.19g024900

Limit To All Plant Sequences

>Glyma.19g024900.1.p sequence-type=predicted peptide transcript=Glyma.19g024900.1 locus=Glyma.19g024900 ID=Glyma.19g024900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSSTAKIFAKLHYKPIQKKTSLKIKFDQSILIIGGGPTGVELAGARLTLVHKGARLLEFVGAKAEDKTLNWLKSKNVVVKLEQSKIYQTSNGGTIEADCHFLCIGKPLASAWLKETVLKNDLDGQGRIKVDERLRVKGRNNIFAIGDVTDIPEIKQGFLAQQQLEVVVKNLNLPFLTISGRIPGFIKSRDLFVGKTRKQMGLNPVHI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain