Glyma.18g296900

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.18g296900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.18g296900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.18g296900

Feature Type:	gene_model
Chromosome:	Gm18
Start:	57410466
stop:	57411555
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.18g296900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G67090.1	AT	ribulose bisphosphate carboxylase small chain 1A	JGI	N/A	IEA
GO:0009853	GO-bp	photorespiration	EnsemblGenomes	N/A	IEA
GO:0015977	GO-bp	carbon fixation	EnsemblGenomes	N/A	IEA
GO:0015979	GO-bp	photosynthesis	EnsemblGenomes	N/A	IEA
GO:0055114	GO-bp	oxidation-reduction process	EnsemblGenomes	N/A	IEA
GO:0009507	GO-cc	chloroplast	EnsemblGenomes	N/A	IEA
GO:0009536	GO-cc	plastid	EnsemblGenomes	N/A	IEA
GO:0004497	GO-mf	monooxygenase activity	EnsemblGenomes	N/A	IEA
GO:0016491	GO-mf	oxidoreductase activity	EnsemblGenomes	N/A	IEA
GO:0016829	GO-mf	lyase activity	EnsemblGenomes	N/A	IEA
GO:0016984	GO-mf	ribulose-bisphosphate carboxylase activity	EnsemblGenomes	N/A	IEA
PF00101	PFAM	Ribulose bisphosphate carboxylase, small chain	JGI	N/A	IEA
PF12338	PFAM	Ribulose-1,5-bisphosphate carboxylase small subunit	JGI	N/A	IEA
CALVIN-PWY	SoyCyc9	Calvin-Benson-Bassham cycle	Plant Metabolic Network		ISS
PHOTOALL-PWY	SoyCyc9	oxygenic photosynthesis	Plant Metabolic Network		ISS
PWY-5723	SoyCyc9	Rubisco shunt	Plant Metabolic Network		ISS
GN7V-45417	SoyCyc9-rxn	ribulose-bisphosphate carboxylase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.18g296900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g296900 not represented in the dataset	Glyma.18g296900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.18g296900 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma18g53430	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.18g296900

Limit To All Plant Sequences

>Glyma.18g296900.1 sequence-type=CDS polypeptide=Glyma.18g296900.1.p locus=Glyma.18g296900 ID=Glyma.18g296900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTTCCTCTATGATGTCCTCCCCAGCTGTCACCACCGTTAACCGTAGCAGCATGGTGGCTCCATTCACTGGCCTCAAGTCTATGGCTGGCTTCCCAGTTACAAAAACTAACTATGACATTAATTCTATCGCAAGCAACAGTGAAAGAGTACAATGCATGCAGCAAGGTTTTGTGTACCGTGAGAATCACCGATCACCTGAATACAATGATGGAAGGTACTGGACAATGTGGAAGCTACCAATGATTGGGTGCACAGACTCAGCTCAGGTGTTGAAGGGGGTTGATGAGGCCGTTAAGGCCTACCCTACTGCCTTCGTTCGTATCATTGGATTCGACAATGTTCGTCAAGTCCAATGCGTCATTTTCATTGCCTACAAGTCCAATGCATCATTTTCATTGCCTACAAGTCCCCTGGCTACTAAACTTGAATTTTACAAGAGCCATTTGTAG

Predicted protein sequences of Glyma.18g296900

Limit To All Plant Sequences

>Glyma.18g296900.1.p sequence-type=predicted peptide transcript=Glyma.18g296900.1 locus=Glyma.18g296900 ID=Glyma.18g296900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASSMMSSPAVTTVNRSSMVAPFTGLKSMAGFPVTKTNYDINSIASNSERVQCMQQGFVYRENHRSPEYNDGRYWTMWKLPMIGCTDSAQVLKGVDEAVKAYPTAFVRIIGFDNVRQVQCVIFIAYKSNASFSLPTSPLATKLEFYKSHL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain